KEGG   Mus musculus (mouse): 20430Help
Entry
20430             CDS       T01002                                 

Gene name
Cyfip1, E030028J09Rik, P140SRA-1, P140sra1, Shyc, Sra-1, Sra1, l(7)1Rl, l71Rl, l7Rl1, mKIAA0068, pl-1
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 1
  KO
K05749  
cytoplasmic FMR1 interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    20430 (Cyfip1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    20430 (Cyfip1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     20430 (Cyfip1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     20430 (Cyfip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B5
AA seq 1253 aa AA seqDB search
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVC
DLLHAAPFQNILPRIHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRTFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccaagtgacactagaggacgcactgtccaatgtggacctcctggaggagctg
cctctgcctgaccagcagccctgcatcgagcccccaccgtcctcgctgctctatcagcca
aatttcaacaccaactttgaagacagaaatgcatttgtcactggcattgcaagatacatc
gaacaagcaactgtccactctagcatgaacgagatgctagaggaaggccaagagtatgct
gtcatgctgtacacctggaggagctgctcccgggccatccctcaggtgaagtgcaacgag
cagccgaatagagttgaaatttatgagaaaaccgtggaagtccttgaacccgaggtcaca
aaactgatgaattttatgtactttcagagaaatgccatcgagcggttctgtggggaagtg
agacgcctgtgtcatgctgagaggagaaaggactttgtttctgaagcctacttgatcacc
ctgggcaaatttatcaacatgtttgctgtgttggatgagctgaagaacatgaagtgcagt
gtgaagaatgaccactctgcatataagagggctgctcagtttttacgtaaaatggcagat
ccacaatccatccaggagtcacagaatctgtccatgttcctggccaaccacaacaagatt
acacaatctctgcagcagcagcttgaggtcatttctggctatgaagagctcctggcagac
atcgtgaatctgtgtgtggattactatgagaacaggatgtacttgacacccagcgaaaaa
cacatgcttctcaaagtcatgggatttggcctgtacctgatggatgggagtgtgagtaac
atctacaaactagatgccaagaaaagaataaatttatccaaaatcgacaagtatttcaag
cagctgcaggtggttccactctttggagatatgcaaatagaactggcaagatacatcaag
accagcgcacactatgaggagaataagtcccggtggacctgcgcgtcctccagcagcagc
ccgcagtacaacatctgtgagcagatgatccagatccgtgaggaccatatgcgtttcatc
tccgagctggcacgctacagcaatagcgaggtagtcacagggtctggccggcaggaagcc
cagaagacagatgctgagtaccggaagctcttcgatctggctctgcagggcctgcagctt
ctgtcgcagtggagcgctcacgtgatggaagtgtattcctggaaacttgtacatccaaca
gacaagtactccaacaaggactgccccgacaacgctgaggagtacgagcgagccacacgc
tacaactacaccactgaggagaagtttgccctggtggaggtgattgccatgatcaaaggc
ctgcaggtgctgatgggcaggatggagagtgtgttcaatcacgccatcagacacacggtt
tacgctgcgcttcaggacttctcccaggtgaccctcagggaaccactgcgacaggccatc
aagaagaaaaagaacgtaatccagagtgtcctacaggccatcaggaagactgtgtgtgac
tgggagactgggcatgagccctttaacgacccagctctgcggggagagaaggaccctaag
agtggctttgacatcaaggtgccacgccgtgctgtgggaccctccagcacgcagctttac
atggtgagaactatgctagagtccctcattgcagacaaaagtggttccaagaaaaccttg
agaagtagccttgaggggcccaccatattggacatagaaaaatttcatcgagaatcattc
ttctacactcacttgataaatttcagtgaaacactgcagcagtgctgtgacctttcccag
ctgtggttccgagagttcttcctggagctgaccatgggcaggaggatccagttccccatt
gagatgtctatgccctggattctgactgaccacatcctagagaccaaggaggcatcaatg
atggagtacgtcctctactccttggacctgtacaacgacagtgcccactatgcgctcacc
aagttcaacaagcagtttctctatgatgagattgaggcagaggtgaatctgtgttttgac
caatttgtttataaactagcagaccagatatttgcatattacaaggttatggcaggaagt
ttgcttcttgacaaaaggttacggtcagaatgcaaaaatcagggagccacgatccacctc
cccccatctaaccgctatgagacgctgttgaagcaaaggcacgtgcagctgctcgggaga
tccattgatctcaaccgtctgattacacagcgcgtttcagcagccatgtacaaatctcta
gaactggcaattggacggtttgaaagtgaagatttaacatcagtagtcgagctagatgga
ctcttagaaatcaaccgtatgacacacaagctgttgagcaggtacctcacactggacagc
tttgatgccatgttccgggaagccaaccacaacgtgtctgcaccttatggaagaattacc
ctccacgtcttctgggagctaaactatgacttcttgcccaactactgctataatggctct
accaaccggtttgttcggacagtattaccattttctcaggaatttcaaagagacaaacag
cctaacgcacagccccagtatttgcatggatccaaggctttgaacctagcctactcaagc
atttatggcagctaccggaactttgtggggcctccgcacttccaagtcatctgccggcta
cttggctaccagggcattgcagtagtcatggaagagctgctgaaggttgtcaagagcctg
ctgcaaggcacaatcctgcagtacgtgaaaactctgatggaagtgatgcccaagatctgc
cggcttccgcgacatgagtacggctctcctggcatcctggagttcttccaccaccagctg
aaggacattgtggagtatgcagagctgaaaaccgtatgcttccagaacctgcgggaggtg
ggcaatgctgttctcttctgcctgcttattgagcaaagcctgtctttagaagaagtctgt
gacctgttgcatgcagctcctttccagaatatcttacctcgaatccatgtaaaagagggg
gagagagttgatgccaaaatgaaaagactagaatccaagtatgccccactgcaccttgtc
ccactgattgaaaggctggggaccccacagcaaattgcaattgcaagagagggggacttg
ctaaccaaggagcgtctctgttgtggtctgtccatgtttgaagtcatcctgacacggatc
cggacctttctggatgatcccatctggcgtgggcccctacccagcaatggtgtcatgcac
gtggatgagtgtgtggagtttcacagactatggagtgccatgcagtttgtttactgcatt
cctgtagggacacacgagtttacagtggagcagtgttttggagatgggctccactgggct
ggctgcatgatcattgtacttcttggacagcagcggcgctttgctgtgttggatttctgc
tatcatcttctcaaagttcagaaacatgatggcaaagatgagatcatcaaaaatgtgcca
ttgaagaagatggtggagaggatccgcaagttccagattctcaacgatgaaatcatcact
atcctggacaagtacttgaaatctggtgatggcgagagcacacctgtggagcatgtacgc
tgcttccagccacccatccaccagtccctagccagtagctga

DBGET integrated database retrieval system