KEGG   Mus musculus (mouse): 20440Help
Entry
20440             CDS       T01002                                 

Gene name
St6gal1, AW742324, Siat1, St6Gal-I, St6gal, St6galI
Definition
beta galactoside alpha 2,6 sialyltransferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:mmu00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mmu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B1; 16 14.03 cM
AA seq 403 aa AA seqDB search
MIHTNLKRKFSCFVLVFLLFAIICVWKKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAV
FSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYK
VSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHK
CAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRF
LKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWE
LWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSA
CTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattcataccaacttgaagagaaagttcagctgctttgtcctggtctttctcctgttt
gccatcatctgcgtgtggaagaaagggagcgactatgaggctcttacattgcaagccaag
gtattccagatgccgaagagccaggagaaagtggccgtggggcctgctccccaggctgtg
ttctcaaacagcaaacaagaccctaaggaaggcgttcagatcctcagttaccccagggtc
acagccaaggtcaagccacagccctccttgcaggtgtgggacaaggactccacatactca
aaacttaaccccaggctgctgaagatctggaggaactatctgaacatgaataaatataaa
gtgtcctacaaggggccgggaccaggagtcaagttcagcgtagaggcgctgcgctgccac
cttcgagaccacgtgaatgtgtctatgatagaggccacagattttcccttcaacaccact
gaatgggagggttacctgcccaaggagaacttcagaaccaaggctgggccttggcataag
tgtgccgtcgtgtcttctgcaggatctctgaagaactcccagctgggtcgagagattgat
aatcatgatgcggtcctgaggtttaatggggcacctacagacaacttccaacaggatgtg
ggcacaaaaactaccatccgcctagtgaactctcagttagtcaccacagaaaagcgcttc
ctgaaggacagtttgtacaccgaaggaatcctgattctgtgggacccatctgtgtatcat
gcagacattccgcagtggtatcagaagccagactacaacttcttcgaaacctataagagt
taccgaaggcttcaccccagccagcctttttacatcctcaagccccagatgccatgggaa
ctatgggacatcattcaggaaatctctccagatctgattcagccgaatcccccatcctcc
ggcatgctgggtatcatcattatgatgacgctgtgtgaccaagttgatatttacgagttc
ctcccatccaagcgcaagacagatgtgtgctactatcaccagaagttctttgacagcgcc
tgcacgatgggtgcctaccatccgctcctcttcgagaagaatatggtgaagcatctcaat
gagggaacagatgaagacatttatttgtttgggaaagctaccctgtctggcttccggaac
aatcgctgttga

DBGET integrated database retrieval system