KEGG   Mus musculus (mouse): 20440Help
Entry
20440             CDS       T01002                                 

Gene name
St6gal1, AW742324, Siat1, St6Gal-I, St6gal, St6galI
Definition
beta galactoside alpha 2,6 sialyltransferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    20440 (St6gal1)
   00514 Other types of O-glycan biosynthesis
    20440 (St6gal1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     20440 (St6gal1)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   20440 (St6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B1; 16 14.03 cM
AA seq 403 aa AA seqDB search
MIHTNLKRKFSCFVLVFLLFAIICVWKKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAV
FSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYK
VSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHK
CAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRF
LKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWE
LWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSA
CTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattcataccaacttgaagagaaagttcagctgctttgtcctggtctttctcctgttt
gccatcatctgcgtgtggaagaaagggagcgactatgaggctcttacattgcaagccaag
gtattccagatgccgaagagccaggagaaagtggccgtggggcctgctccccaggctgtg
ttctcaaacagcaaacaagaccctaaggaaggcgttcagatcctcagttaccccagggtc
acagccaaggtcaagccacagccctccttgcaggtgtgggacaaggactccacatactca
aaacttaaccccaggctgctgaagatctggaggaactatctgaacatgaataaatataaa
gtgtcctacaaggggccgggaccaggagtcaagttcagcgtagaggcgctgcgctgccac
cttcgagaccacgtgaatgtgtctatgatagaggccacagattttcccttcaacaccact
gaatgggagggttacctgcccaaggagaacttcagaaccaaggctgggccttggcataag
tgtgccgtcgtgtcttctgcaggatctctgaagaactcccagctgggtcgagagattgat
aatcatgatgcggtcctgaggtttaatggggcacctacagacaacttccaacaggatgtg
ggcacaaaaactaccatccgcctagtgaactctcagttagtcaccacagaaaagcgcttc
ctgaaggacagtttgtacaccgaaggaatcctgattctgtgggacccatctgtgtatcat
gcagacattccgcagtggtatcagaagccagactacaacttcttcgaaacctataagagt
taccgaaggcttcaccccagccagcctttttacatcctcaagccccagatgccatgggaa
ctatgggacatcattcaggaaatctctccagatctgattcagccgaatcccccatcctcc
ggcatgctgggtatcatcattatgatgacgctgtgtgaccaagttgatatttacgagttc
ctcccatccaagcgcaagacagatgtgtgctactatcaccagaagttctttgacagcgcc
tgcacgatgggtgcctaccatccgctcctcttcgagaagaatatggtgaagcatctcaat
gagggaacagatgaagacatttatttgtttgggaaagctaccctgtctggcttccggaac
aatcgctgttga

DBGET integrated database retrieval system