KEGG   Mus musculus (mouse): 20465Help
Entry
20465             CDS       T01002                                 

Gene name
Sim2, bHLHe15
Definition
(RefSeq) single-minded homolog 2 (Drosophila)
  KO
K09100  
single-minded
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    20465 (Sim2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
16 55.05 cM; 16 C3.3-C4
AA seq 657 aa AA seqDB search
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRTGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHPPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDL
KLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDTFHLRYAHHLLLVKGQVTTKYYRLLSK
LGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTDVEYKELQLSLDQVSTSKSQESWRTTL
STSQETRKSAKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECSQVGNWRTSPPTNAVAPPE
QQLHSEASDLLYGPPYSLPFSYHYGHFPLDSHVFSSKKPGLPAKFGQPQGSPCEVARFFL
STLPASSECQWHCANSLVPSSSSPAKNLSEPSPVNAARHGLVPNYEAPSAAARRFCEDPA
PPSFPSCGHYREEPALGPAKAPRQASRDAARLALARAPPECCAPPAPEPQAPAQLPFVLL
NYHRVLARRGPLGSAAPGAPEAAGSLRPRHPGPVAASAPGAPRPHYLGASVIITNGR
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaagtccaaaaatgcggccaaaaccaggagggagaaggaaaatggcgagttt
tacgagctggccaagctgctcccgctgccttcggccatcacctcgcagctggacaaagcg
tccatcatccgactcaccaccagctacctgaagatgcgcgcggtcttcccggaaggtcta
ggagacgcgtggggacagccgagcaggacagggcctctggacagcgtggcaaaagagctg
ggatcccatttgctgcagactctagatggatttgtgttcgtggtggcctctgatggcaaa
atcatgtatatatctgagaccgcttctgtccatttaggcttgtcccaggtggagctcaca
ggcaacagtatttatgaatacatacatccttctgaccacgacgagatgacagccgtactt
acagcccacccaccgctccaccatcacctgctccaagagtacgagatagagcggtctttc
tttcttcgaatgaagtgcgtcttggcaaaacgaaacgcaggcctgacatgcagtggatac
aaggtcattcactgcagcggctacctaaagatcagacagtacatgctggacatgtccctg
tacgactcctgttaccagatcgtggggctggtggccgtgggccagtcgctaccgcccagc
gccatcacggagatcaagctccacagcaacatgttcatgttcagggccagccttgacctg
aagctcatattcctggactccagggtgacagagcttacgggctatgagccacaagacctg
atcgaaaagacactgtaccatcatgtgcatggctgtgacaccttccacctccgatatgca
caccacctcttgctggtgaagggccaggtcaccaccaaatactaccggctgctgtccaag
ctgggcggctgggtctgggtgcagagctacgccaccgtggtgcacaacagccgctcctcc
cggcctcactgcatcgtgagtgtcaattatgttctcacggatgttgaatacaaggaactt
cagctgtctctggaccaggtatccacctctaagtcccaggagtcctggagaaccaccttg
tctacctcacaagaaactaggaaatcagctaaacccaaaaacacaaagatgaagacaaag
ctgagaaccaacccatatcccccacagcaatacagctccttccaaatggacaaactggag
tgcagccaggtgggaaactggagaactagtccccccacaaatgctgtggctcccccggaa
cagcagctccattcagaagccagcgaccttttatatgggccgccctacagcctccccttc
tcctaccattatggacacttcccattggactctcacgtcttcagcagcaagaagccagga
ttgcccgccaagttcgggcagccccaaggatccccgtgtgaggtggcacgcttcttcctg
agcacactgccagccagcagcgaatgccagtggcactgtgccaactctctagtgcccagc
agctcatcgccagctaaaaacctttctgagccttctcctgtgaatgctgcccggcatggt
cttgtgccaaactatgaagcgccctccgcagccgcgcgcaggttctgcgaggaccccgcg
cccccaagcttcccgagctgcggccactaccgcgaggagccggcgctgggccctgccaag
gcgcctcgccaggcgtcccgggacgcagcccggctggcgctggcccgagcgccccccgag
tgctgcgcgccgcccgcccccgagccgcaggcgccggcgcagttgcccttcgtgctgctc
aactaccaccgcgtgctggcgcgccgcgggcctctggggagcgctgcgcccggagccccc
gaggcggccggctcgctgaggccccgacacccaggccccgtcgccgcctctgcgcccggc
gcgccccgaccgcattacctgggcgcctcggtcatcatcaccaacggcaggtga

DBGET integrated database retrieval system