KEGG   Mus musculus (mouse): 20473Help
Entry
20473             CDS       T01002                                 

Gene name
Six3, E130112M24Rik, Six3a, Six3alpha, Six3b, Six3beta
Definition
sine oculis-related homeobox 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 E4; 17 55.42 cM
AA seq 333 aa AA seqDB search
MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGASGGGGGAGGGGGGNRAGGGGAG
GAGGGSGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAP
GACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEK
LRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKREL
AQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPST
AASPTTSVSSLTERADTGTSILSVTSSDSECDV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtattccgctcccccctagatctctattcctcccacttcttgttgccaaacttcgcc
gattctcaccactgctccctacttctggcgagtagcggcggcgggagcggtgcgagcggc
ggcggcggcggcgcgggaggaggcggcggcgggaaccgtgcgggaggcggcggtgctggc
ggagcaggcggcggcagcggcggcggcggctccagggcccccccggaagagttgtccatg
ttccagttgcccaccctcaacttctcgccggagcaggtggccagcgtctgcgagacgctg
gaggagacgggcgacatcgagcggctgggccgcttcctctggtcgctgcccgtggccccc
ggggcgtgcgaggccatcaacaaacacgagtcgatcctgcgcgcgcgcgctgtcgtcgcc
ttccacaccggcaacttccgcgacctgtaccacatcctggagaaccacaagttcactaag
gagtctcacggcaagctgcaagccatgtggctcgaggcgcactaccaggaggccgagaag
ctgcgcggccgcccgctcggcccggtggacaagtaccgcgtgcgcaagaagttccctctg
ccgcgcaccatctgggatggcgagcagaagacccattgcttcaaggagcggactcggagc
ctgctgcgggagtggtacctgcaggatccctaccccaaccccagcaagaaacgcgaactg
gcgcaggccaccggcctcacccccacacaagtaggcaactggtttaagaaccggcgacag
cgcgaccgcgcagcggcggccaagaacaggctccagcatcaggccatcgggccgagcggg
atgcgctcgctggccgagcccggctgccccacgcacggctcagcagagtcaccgtccacg
gcggccagcccgaccaccagtgtgtccagcctgacggagcgcgcggacaccggcacttcg
atcctctcggtaacctccagcgactcggaatgtgatgtatga

DBGET integrated database retrieval system