KEGG   Mus musculus (mouse): 20502Help
Entry
20502             CDS       T01002                                 

Gene name
Slc16a2, AW105741, Mct8, Xpct
Definition
(RefSeq) solute carrier family 16 (monocarboxylic acid transporters), member 2
  KO
K08231  
MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    20502 (Slc16a2)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   20502 (Slc16a2)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    20502 (Slc16a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X D; X 46.29 cM
AA seq 545 aa AA seqDB search
MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPEPEPEPEPEPDPEPVPVPPPEPQPEPE
PQPLPDPAPLPELGFEAEPVQEPEPTPTVETRGTARGFQPPEGGFGWIVVFAATWCNGSI
FGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITA
TTGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGV
VSAGSSIFSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLTLLSLTYRPLLPSSQDTPSKR
GAHTLRQRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEDKFKEIK
ETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLI
VVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFG
DYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLSHDPDPNGELLPGSPT
PEEPI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccaagcccggcgagcgaggaagctgaggggccctgtcaggaggcaaaccag
gaatatcaggagccggtgtgtagtcctgtgcccgagccggagccagagccggagcccgaa
ccggagcctgaccccgagccggtgccagtgcccccgcccgagcctcagcctgagcccgag
ccccagcccctacccgatcctgcacccctgccggagctgggctttgaggctgagccagtg
caagaacccgagcccacgcccactgtggaaacccgaggcaccgcgcgtggctttcagcct
cccgaaggtggcttcggctggatagtggtgtttgcagccacctggtgcaacggctccatc
ttcggcatccataactctgttggtatcctctactccatgctactagaggaggaaaaagag
aaaaatcgccaagtggagttccaagcagcatgggtcggagccctcgctatgggcatgatc
ttcttctgttctcccattgtgagtatattcactgaccgtttgggctgccgaatcacagcc
accaccggggccgctgttgctttcattggcctccacaccagctccttcaccagctcccta
agcctgcgctacttcacctatgggattctgtttggttgtggctgctcattcgcctttcaa
ccatcactcgtcatcctgggccactactttcaacgtcgcctaggtctagccaatggtgtg
gtatctgctggaagtagcatcttctccatgtcttttcccttcctcatcaaaatgctgggg
gataaaatcaagctggcccaaaccttccaggtgctgagtaccttcatgtttgtccttacg
ctgctctcactcacttaccggcccctcctgccaagctcccaggacaccccaagcaagaga
ggtgcccacaccctgcgacagcgctttctggttcagttcagaaagtacttcaacatgcgt
gtattccgccagcgcacttaccgtatctgggcctttgggatcgctgctgctgcccttggt
tacttcgtcccctacgtgcacctgatgaaatatgtggaagataagttcaaggagatcaag
gagacctgggtgctcttggtgtgcattggggctacgtcaggcctcggacgtctcgtctcg
ggccacatcagtgactccatccctggacttaagaagatatacttgcaggtcctctcattc
ctgctcctgggcttgatgtccatgatgatccccctatgccgggacttcgggggccttatc
gttgtctgcctcttcctgggcctatgtgatggcttcttcattaccatcatggctcccatt
gcatttgagctggtgggacccatgcaggcctcacaggccattggctacctcctgggcatg
atggccctgccaatgattgctgggccccccattgcaggcctccttcgaaactgctttggt
gattaccatgtggccttctactttgcgggtgtccccccaatcattggagctgtgatcctt
ttcttcgtccctctgatgcatcaaaggatgtttaagaaagagcagagagattccagcaag
gataagatgctgtcccacgatccagaccccaacggagaactgctgccaggctccccaaca
cctgaagagcccatttaa

DBGET integrated database retrieval system