KEGG   Mus musculus (mouse): 20597Help
Entry
20597             CDS       T01002                                 

Gene name
Smpd1, A-SMase, ASM, Zn-SMase, aSMase
Definition
(RefSeq) sphingomyelin phosphodiesterase 1, acid lysosomal (EC:3.1.4.12)
  KO
K12350  
sphingomyelin phosphodiesterase [EC:3.1.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    20597 (Smpd1)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    20597 (Smpd1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    20597 (Smpd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     20597 (Smpd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
7 E3; 7 55.9 cM
AA seq 627 aa AA seqDB search
MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWMGLGLALVLALFDSTVLWVPARAYPL
PSEGHSVKFSAIAPPLQSAFGWQNLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKM
LNIAPLDVCQSAVHLFEDDVVEVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVP
KPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAG
FWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDL
VRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLR
IGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHI
IGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLA
PSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARET
YGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARAD
SPALCRHLMPNGSLPDANRLWSRPLLC
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccacagagcatcatccggccaggaccacctcagagccggctgggagcagaga
ctggagaggtccttaccggcacccagagtgggactcctttggatggggctgggcttggcg
ctggttctggctctgtttgactccacggttctttgggttcctgccagagcttatcctctt
ccttctgaaggccattctgtcaaattcagtgccatagcgccgccgctccagagtgccttt
gggtggcagaacctcacttgccccgcctgcaaagtcttattcactgctctcaaccatggg
ctgaagaaggagcccaatgtggcacgggtaggctctgtggccatcaagatatgcaagatg
ctgaacatagcaccactagatgtgtgccagtcagccgtccatctctttgaggacgatgtg
gtggaggtgtggacacgttcagttctgagcccatcagaggcttgtggcttgcttctgggc
tcctcttgtggacactgggacatcttttcgacttggaacatctctttgccatcagtgccg
aagccacccccaaagccaccgagcccaccagcccccggtgcccctgtcagccgtgtcctc
ttccttactgatctacactgggaccatgagtacctggagggcacagacccttactgtgca
gatccactttgctgccgccgggggtccggatggccacccaactcccagaagggggctggg
ttctggggcgagtacagcaagtgtgacctgcccttgcgaacgctagaaagcctgttgaaa
ggactgggccctgccggcccttttgaaatggtgtactggacgggagatatccctgcccat
gatgtctggcaacagtctcgccaagatcagctgagggccctgaccaccatcacagacctc
gtgaggaagttcttgggcccagtgccagtgtaccctgctgtgggcaaccatgagagcact
cctgtcaatggcttccctcctcccttcataaagggaaaccaatcttcacaatggctctat
gaagccatggccaaggcatgggaaccctggttaccagctgatgcccttcacaccctaaga
attgggggcttctatgccctcaccccacgccctggcctccgcctcatctctctcaatatg
aatttttgttcccgtgagaacttttggctcttgatcaactccacagatcctgctggacaa
ctccagtggctggtggaggagcttcaggctgctgagaatcgaggagacaaagtgcatata
attggccacatccctccaggacattgtcttaagagctggagctggaattattacaaaatc
atagccaggtatgaaaacactctggccggtcagttctttggccacactcacgtggatgag
tttgagatcttctatgatgaggaaactctgagccgaccactagctgtagccttcctggcg
cccagtgctacaacctttatcaaccttaaccctggctaccgagtttaccaaatagatgga
aactaccccggaagctctcatgtggtcctggaccacgagacctacatcttgaatctgacc
caggccaacgcagcaggaggcacaccaagctggaagcgcctctacagggctcgagaaacc
tatggacttccagatgcgatgcctgcctcctggcacaacctggtctaccgcatgagggat
gatgagcaactcttccagaccttctggtttctctaccataagggccacccaccttcagag
ccctgcggcacaccctgccgcctggccactctgtgtgcccagctctcagcccgagcagac
agccctgctttgtgtcgccacttgatgcccaatgggagcctcccagatgctaataggttg
tggtcacgccccctgttgtgctag

DBGET integrated database retrieval system