KEGG   Mus musculus (mouse): 20597Help
Entry
20597             CDS       T01002                                 

Gene name
Smpd1, A-SMase, ASM, Zn-SMase, aSMase
Definition
(RefSeq) sphingomyelin phosphodiesterase 1, acid lysosomal
  KO
K12350  
sphingomyelin phosphodiesterase [EC:3.1.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
Lysosome
Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    20597 (Smpd1)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    20597 (Smpd1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    20597 (Smpd1)
  Cell growth and death
   04217 Necroptosis
    20597 (Smpd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     20597 (Smpd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7 E3; 7 55.9 cM
AA seq 627 aa AA seqDB search
MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWMGLGLALVLALFDSTVLWVPARAYPL
PSEGHSVKFSAIAPPLQSAFGWQNLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKM
LNIAPLDVCQSAVHLFEDDVVEVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVP
KPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRRGSGWPPNSQKGAG
FWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRALTTITDL
VRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLR
IGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHI
IGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLA
PSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARET
YGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARAD
SPALCRHLMPNGSLPDANRLWSRPLLC
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccacagagcatcatccggccaggaccacctcagagccggctgggagcagaga
ctggagaggtccttaccggcacccagagtgggactcctttggatggggctgggcttggcg
ctggttctggctctgtttgactccacggttctttgggttcctgccagagcttatcctctt
ccttctgaaggccattctgtcaaattcagtgccatagcgccgccgctccagagtgccttt
gggtggcagaacctcacttgccccgcctgcaaagtcttattcactgctctcaaccatggg
ctgaagaaggagcccaatgtggcacgggtaggctctgtggccatcaagatatgcaagatg
ctgaacatagcaccactagatgtgtgccagtcagccgtccatctctttgaggacgatgtg
gtggaggtgtggacacgttcagttctgagcccatcagaggcttgtggcttgcttctgggc
tcctcttgtggacactgggacatcttttcgacttggaacatctctttgccatcagtgccg
aagccacccccaaagccaccgagcccaccagcccccggtgcccctgtcagccgtgtcctc
ttccttactgatctacactgggaccatgagtacctggagggcacagacccttactgtgca
gatccactttgctgccgccgggggtccggatggccacccaactcccagaagggggctggg
ttctggggcgagtacagcaagtgtgacctgcccttgcgaacgctagaaagcctgttgaaa
ggactgggccctgccggcccttttgaaatggtgtactggacgggagatatccctgcccat
gatgtctggcaacagtctcgccaagatcagctgagggccctgaccaccatcacagacctc
gtgaggaagttcttgggcccagtgccagtgtaccctgctgtgggcaaccatgagagcact
cctgtcaatggcttccctcctcccttcataaagggaaaccaatcttcacaatggctctat
gaagccatggccaaggcatgggaaccctggttaccagctgatgcccttcacaccctaaga
attgggggcttctatgccctcaccccacgccctggcctccgcctcatctctctcaatatg
aatttttgttcccgtgagaacttttggctcttgatcaactccacagatcctgctggacaa
ctccagtggctggtggaggagcttcaggctgctgagaatcgaggagacaaagtgcatata
attggccacatccctccaggacattgtcttaagagctggagctggaattattacaaaatc
atagccaggtatgaaaacactctggccggtcagttctttggccacactcacgtggatgag
tttgagatcttctatgatgaggaaactctgagccgaccactagctgtagccttcctggcg
cccagtgctacaacctttatcaaccttaaccctggctaccgagtttaccaaatagatgga
aactaccccggaagctctcatgtggtcctggaccacgagacctacatcttgaatctgacc
caggccaacgcagcaggaggcacaccaagctggaagcgcctctacagggctcgagaaacc
tatggacttccagatgcgatgcctgcctcctggcacaacctggtctaccgcatgagggat
gatgagcaactcttccagaccttctggtttctctaccataagggccacccaccttcagag
ccctgcggcacaccctgccgcctggccactctgtgtgcccagctctcagcccgagcagac
agccctgctttgtgtcgccacttgatgcccaatgggagcctcccagatgctaataggttg
tggtcacgccccctgttgtgctag

DBGET integrated database retrieval system