KEGG   Mus musculus (mouse): 20605Help
Entry
20605             CDS       T01002                                 

Gene name
Sstr1, SRIF-2, SS-1-R, SS1-R, SS1R, Smstr-1, Smstr1, sst1
Definition
(RefSeq) somatostatin receptor 1
  KO
K04217  
somatostatin receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    20605 (Sstr1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    20605 (Sstr1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Somatostatin
    20605 (Sstr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 C1; 12 25.61 cM
AA seq 391 aa AA seqDB search
MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCASRISTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaatggcaccgcctcctctccctcctcttctccaagccccagcccaggcagc
tgcggggaaggagcctgcagcaggggtccggggtccggcgctgcggacggcatggaagag
cctggacgaaacgcttcccagaatgggaccttaagcgagggacagggtagcgccattctc
atctctttcatctactccgtggtatgcttggtgggactgtgtgggaactctatggtcatc
tatgtgatcctgcgctacgccaagatgaagaccgctaccaacatctacattctaaacctg
gctattgctgatgagctgctcatgctcagcgtgccctttctggtcacttccacgctgttg
cgccactggcccttcggcgcgctactttgccgcctggtgctcagcgtggatgcggtcaac
atgttcaccagcatctactgtctgactgtgcttagtgtggaccgctatgtggctgtggtg
cacccgatcaaggcagcgcgctaccgtcggcccactgtggccaaagtagtgaacctgggc
gtgtgggtcctgtcattactggttatcttgcccatcgtggtcttctcacgcaccgcagcc
aacagcgatggcacggtagcctgcaacatgctcatgcccgagcccgcccagcgctggttg
gtgggcttcgtcttatacacatttctcatgggcttcctgctgcctgtcggggccatttgc
ctgtgttatgtgctcatcattgccaagatgcgcatggtggccctcaaggctggctggcag
cagcgcaagcgctcagagcgcaagatcactctaatggtgatgatggtggtgatggttttt
gtcatctgctggatgcctttctacgtggtacagctggtcaacgtgttcgccgagcaagac
gacgccaccgtgagccagttgtctgtcatcctgggctatgccaacagctgtgccaacccc
atcctctacggcttcctgtcggacaacttcaagcgctctttccagcgcatcctgtgcctc
agctggatggataacgctgcggaggaaccagtcgactactatgccactgccctgaagagt
cgagcctacagcgtggaggacttccagcccgagaatctggagtctggaggcgttttccgt
aatggcacctgcgcttccaggatcagcacgctttga

DBGET integrated database retrieval system