KEGG   Mus musculus (mouse): 20616Help
Entry
20616             CDS       T01002                                 

Gene name
Snap91, 91kDa, AP180, F1-20, mKIAA0656
Definition
(RefSeq) synaptosomal-associated protein 91
  KO
K20043  
clathrin coat assembly protein AP180
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    20616 (Snap91)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 E3.2
AA seq 901 aa AA seqDB search
MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMA
DTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDM
STFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVMRTMVPEKLLKSMPILQGQIDALLE
FDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRF
LTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQHLNTLEGKKPGNNEGSGAPS
PLSKSSPATTVTSPNSTPAKTIDTSPPVDIFATASAAAPVSSAKPSSDLLDLQPDFSGAA
AGAAAPVVPPSGGATAWGDLLGEDSLAALSSVPCEAPISDPFAPEPSPPTTTTEPASASA
STTTAVTAVTTEVDLFGDAFAASPGEAPAASEGATAPATPAPVAAALDACSGNDPFAPSE
GSAEAAPELDLFAMKPPETSAPVVTPTASTAPPVPATAPSPAPTAVAATAATTTAAAAAT
TTATTSAAAATTAAAPPALDIFGDLFDSAPEVAAAPKPDAAPSIDLFGTDAFSSPPRGAS
PVPESSLTADLLSVDAFAAPSPASTASPAKAESSGVIDLFGDAFGSGASETQPAPQAVSS
SSASADLLAGFGGSFMAPSTTPVTPAQNNLLQPSFEAAFGTTPSTSSSSSFDPSVFDGLG
DLLMPTMAPSGQPAPVSMVPPSPAMAASKGLGSDLDSSLASLVGNLGISGTTSKKGDLQW
NAGEKKLTGGANWQPKVTPATWSAGVPPQGTVPPTSSVPPGAGAPSVGQPGAGFGMPPSG
TGMTMMSQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPATQSPKKPPAKDPLADLNIKDF
L
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccaaacgctcacggatcggatcgccgccgctcagtacagcgtgactggctct
gctgtagcaagagcagtctgcaaagccaccactcatgaggtgatgggccccaagaagaag
cacctggactatttgatccaggctaccaatgagaccaatgtcaatatccctcagatggcc
gacaccctctttgagcgggcgacaaacagtagctgggtggtggtatttaaagctttagtg
accacacaccatctcatggtgcatggaaatgagagatttattcagtatttggcctctagg
aatacgctattcaatctcagcaactttctagataaaagtggatcccacggttatgatatg
tctacgttcatacggcgttacagtagatacttgaatgaaaaggctttctcctacagacag
atggcatttgactttgccagagtgaagaaaggggctgacggtgtcatgaggacgatggtt
cctgaaaagctcctgaagagtatgccaatcctgcaggggcagatcgatgcactgctggag
tttgatgtgcatccaaatgaactaaccaatggtgtcataaatgctgcatttatgcttctt
ttcaaagatcttatcaaactgtttgcttgctacaatgacggcgtcattaacttacttgaa
aaatttttcgagatgaagaaaggtcaatgcaaagacgcgctagaaatttacaagcgattt
ctaactagaatgacgagggtgtctgaattcctcaaggtcgccgagcaagttggtattgat
aaaggtgacattcccgacctcacacaggctcccagcagtcttatggagacccttgaacaa
catctaaataccctagaaggaaagaaacctggaaacaatgaaggatctggtgctccctct
ccactaagtaagtcttctccagccacaactgttacatctcctaattctacaccagctaaa
actatcgacacatccccgccagttgacatatttgcaacagcatccgcggctgccccagtc
agctctgctaagccatcaagcgatctccttgatcttcagcccgacttctctggagcagct
gcgggggcagcagcacctgtagtgcctccttctgggggtgcgaccgcctggggagacctt
ttgggagaggattccttggctgcactttcctctgttccctgtgaagcaccgatttcagac
ccatttgcaccagagccttcccctcctactacaaccactgagcctgcttcagcctctgcc
tcgaccaccacagctgtgacggctgtcactacggaagtggatctctttggagatgccttt
gcagcttctcctggggaggcccctgcagcatccgaaggggctaccgcaccagctaccccg
gccccagtggctgcagctcttgatgcatgctcaggaaatgacccttttgccccatctgaa
ggtagcgcagaggctgcacctgagctggacctctttgcaatgaagccacctgagaccagc
gctcctgtagttacccctacagctagcacagcccctccagttcccgcaactgctccttct
cctgctcccacggctgtggcagccactgctgccaccaccaccgccgccgctgcagctacc
accactgccaccacctctgctgctgctgccaccaccgccgctgctcctcctgctctagat
atctttggtgatttgtttgattctgctcctgaagttgctgcagcacctaagccagacgcg
gctcctagcatagacctgtttggcacagatgctttctcctccccgccacgaggggcctct
ccggtgcctgagagttctctcactgctgacctcttatctgtggacgcatttgcagcgccg
tctcctgcatccactgcctctcctgcaaaggcggagtcctcgggtgtcatagaccttttt
ggggatgcgtttggaagtggtgcttctgaaacccagccagcaccacaggctgtttctagt
tcatcagcatcggcagatctactagctggatttgggggttctttcatggccccttctaca
acgccagtgactccagctcagaataacctgctgcaacccagtttcgaggcagcttttgga
acgacgccttcgacttcaagcagcagctcttttgacccatcagtgtttgatggtttaggc
gatcttctgatgccaaccatggcaccatccgggcagcctgcccctgtctcaatggtccca
cccagtcctgcaatggcagccagcaaaggcctcggaagtgaccttgactcgtctctggcc
agtttagtaggcaatcttgggatttctggtaccacatcaaaaaagggagatctccagtgg
aatgctggggagaaaaagctgactggtggagccaactggcaaccgaaagtcactccagcc
acatggtcagcgggtgttcccccgcaaggcactgttccaccaaccagctcagtccctccg
ggtgccggggccccgtccgttgggcaacctggagcaggatttggaatgcctccttcaggg
acaggcatgaccatgatgtctcagcagccagtcatgtttgcacagcccatgatgaggcca
ccctttggagctgcagctgtgcccggcacacagctttctccaagccctacacctgccact
cagagtcccaagaaacctccagccaaggacccgttagcggatcttaacatcaaggatttc
ttgtaa

DBGET integrated database retrieval system