KEGG   Mus musculus (mouse): 20663Help
Entry
20663             CDS       T01002                                 

Gene name
Sos2, SOS-2, mSOS-2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    20663 (Sos2)
   04010 MAPK signaling pathway
    20663 (Sos2)
   04012 ErbB signaling pathway
    20663 (Sos2)
   04630 Jak-STAT signaling pathway
    20663 (Sos2)
   04068 FoxO signaling pathway
    20663 (Sos2)
   04151 PI3K-Akt signaling pathway
    20663 (Sos2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    20663 (Sos2)
  Cellular commiunity
   04510 Focal adhesion
    20663 (Sos2)
   04540 Gap junction
    20663 (Sos2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    20663 (Sos2)
   04660 T cell receptor signaling pathway
    20663 (Sos2)
   04662 B cell receptor signaling pathway
    20663 (Sos2)
   04664 Fc epsilon RI signaling pathway
    20663 (Sos2)
   04062 Chemokine signaling pathway
    20663 (Sos2)
  Endocrine system
   04910 Insulin signaling pathway
    20663 (Sos2)
   04912 GnRH signaling pathway
    20663 (Sos2)
   04915 Estrogen signaling pathway
    20663 (Sos2)
   04917 Prolactin signaling pathway
    20663 (Sos2)
  Nervous system
   04722 Neurotrophin signaling pathway
    20663 (Sos2)
  Development
   04320 Dorso-ventral axis formation
    20663 (Sos2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    20663 (Sos2)
   05206 MicroRNAs in cancer
    20663 (Sos2)
   05205 Proteoglycans in cancer
    20663 (Sos2)
   05214 Glioma
    20663 (Sos2)
   05221 Acute myeloid leukemia
    20663 (Sos2)
   05220 Chronic myeloid leukemia
    20663 (Sos2)
   05211 Renal cell carcinoma
    20663 (Sos2)
   05215 Prostate cancer
    20663 (Sos2)
   05213 Endometrial cancer
    20663 (Sos2)
   05223 Non-small cell lung cancer
    20663 (Sos2)
  Substance dependence
   05034 Alcoholism
    20663 (Sos2)
  Infectious diseases
   05160 Hepatitis C
    20663 (Sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12 C3-D; 12 28.93 cM
AA seq 1332 aa AA seqDB search
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLLDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKLKA
CSEEQEDKECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDACEYRHAFELVSKDENSVIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPDMYRFVVTDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLNLLIERFEIPEPEPTEADKLA
LEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHYYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESSPPPVEWHISRTGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
DAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPHSKTFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDALNSKGAVKSDDDPPAIPPRQPPPPKVKPRVPVLMGTFDGPV
PSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSPS
TPPTTPSPRIPRSCHLLSSSHSSLAHLPAPPVPPRQNSSPLLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagaaaacagcccgaaatggcgg
ggactattggtcccggccctgcggaaggttcaggagcaagtacatcccaccctctcagct
aatgaagagtctctctattatattgaagaactgatttttcagctgcttaataagctatgc
atggctcaaccaaggactgttcaagatgttgaggaacgagttcaaaagacctttcctcat
cctattgataaatgggcaattgctgatgcacaatctgctatagagaaacgaaaacgaaga
aatcctctcttactacctgtggacaaaatccatccttccttgaaggaagttttggggtat
aaagtggactaccatgtgtccctctacattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcaa
gacattaaagtgtccatgtgtgcagataaggttttgatggacatgttcgatcaggatgat
gatataggcttggtttctctctgtgaagatgagccttgttcttctggtgagctaaactat
tatgacctcgtcaggactgaaattgcagaagaaagacagtatctacgggagctgaatatg
atcattaaagtgttccgggaagcctttctcttggacagaaagttgttcaagccttctgaa
attgaaaagattttcagtaacatttcagatatacatgaattgactgtgaaacttttaggt
ttaattgaagacacagtagaaatgacagatgaaagtagtcctcatccattagctggtagc
tgttttgaagatttagcagaggagcaagcgtttgatccctatgaaacattatcacaggac
attcttgcaccagagtttaatgaccacttcagcaagttgatggccagacctgcagtcgct
ctacattttcagtccattgctgacggctttaaggaggctgttcgttatgtccttccacgc
ctcatgctggttcccgtgtatcactgttggcattactttgaattattaaagttgaaggca
tgcagtgaagagcaggaggacaaagagtgcttgaatcaggctataactgccctcatgaac
ctccaaggcagcatggaccgcatttacaagcagcactcccccagacgccggcctggggat
ccagtttgccttttttacaatcgtcaattaagaagcaaacacctggctatcaaaaaaatg
aatgaaattcagaaaaacatagatgggtgggaaggcaaagatatcggacagtgttgtaat
gagttcataatggaggggccactgaccagaattggtgctaaacacgaaaggcatatcttt
ctctttgatggcttaatgatcagctgtaaacccaatcatggccagacccggcttccagga
tatagcagtgcagaatacagattaaaggagaagtttgtcatgaggaaaattcaaatctgt
gataaggaagacgcctgtgagtacagacatgcttttgaattagtgtccaaagatgaaaac
agtgtaatatttgctgccaaatcagctgaagagaaaaacaactggatggcagccctcatt
tccctgcactatcgcagcactctagacagaatgctggactctgtgctgctgaaagaagag
aatgagcagcccctgaggctacccagtccagatatgtatcgctttgtggtaacagactct
gaggaaaacattgtgtttgaagacaacttgcaaagcagaagtgggatccccataattaaa
ggaggcactgtggtgaagttgatcgaaaggctaacataccacatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaaac
ttgctgatagaacggtttgaaattccagaaccagaacctactgaggcagacaagctggcg
ttagaaaaaggcgagcagccaatcagcgcagatctgaaaagattccgcaaggaatacgtc
caacctgtgcagcttagggtcttgaatgtctttcgccactgggttgagcatcattattat
gactttgaaagagacttggaactgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagccatgaagaaatgggtagaatccattgctaaaataatcaagaggaagaagcaa
gctcaggcaaatggaataagccataatatcacctttgaaagttcccccccaccagtggaa
tggcacatcagtagaacaggacagttcgaaacatttgaccttatgacacttcatccaata
gagatcgcacggcagctaacacttttggaatctgacctctacaggaaagtccagccctct
gaacttgtagggagtgtctggaccaaagaagataaagaaataaattctccaaacttatta
aaaatgattcgccatacaacaaacctcaccctatggtttgagaaatgcattgtggaagca
gaaaactttgaagaacgggtggcagtgctcagcagaatagtagaaattctgcaagtattt
caagacttgaataatttcaatggcgtgttggagatagtgagtgcagtcaactccgtgtca
gtgtacaggctagaccacacgtttgaggcactgcaggaaaggaagcggagaattttggat
gacgctgtggaactaagtcaggaccactttaaaaagtacctagtaaaacttaagtcaatc
aatccgccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaacagtgactttctaaagaggaaagggaaagatttgatcaatttcagtaagaggagg
aaagtggctgaaataactggagagatccagcagtatcagaaccaaccgtactgcttacgg
acagaaccagaaatgaggagattctttgaaaacctcaaccccatgggaattttatctgaa
aaagagtttacagattatttgttcaacaaatcattagaaatcgaaccccgaaactgcaaa
caaccacctcgatttcctaggaagtcaaccttttccttaaaatctcctggaataaggccc
aatgctggccgccatggctctacctcaggcacgctacgaggtcacccaacgcctctggaa
agagagccttataagataagctttagccggatcgctgagacagagctagaatcaacagtg
tctgcaccaacctcccccaacactccatccaccccaccagtgtctgcttcttcagaccac
agcgtgtttctagatgtggacctcaatagctcctgtggcagcaacaccatctttgctcca
gtcctcttgccacactcaaagactttcttcagctcatgtggaagtttacacaaactgagt
gaagagccactaattcctcctccgcttccccctcggaaaaagtttgatcatgatgctctc
aattccaagggagctgtgaaatctgatgatgaccctcctgctattccaccaagacagccc
cctcctccgaaggtaaagccaagagttcctgtcctcatgggtacatttgatgggcctgtg
cccagtccacctccacctcctccaagagaccctcttcctgatacccctccaccagttcct
cttcggcctccggaacactttataaactgtccatttaatcttcagccgcctccactgggc
catcctcacagagacccagactggctcagagacgtcagcacgtgtcctaactcaccaagc
actcctcccactacgccctctccacggattccacgcagctgtcacttgctcagctccagt
cacagcagccttgctcatcttccagctcctcctgtcccaccaaggcagaattcaagccct
ctcttaccaaagctgccaccaaagacttacaaacgggagctttcccacccgccactgtat
agactgcctctgctggaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system