KEGG   Mus musculus (mouse): 20663Help
Entry
20663             CDS       T01002                                 

Gene name
Sos2, SOS-2, mSOS-2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mmu04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mmu04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mmu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Cellular Processes; Cell communication; Gap junction [PATH:mmu04540]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:mmu04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mmu04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:mmu04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mmu04664]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:mmu04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mmu04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mmu04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:mmu04915]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:mmu04917]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mmu04722]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:mmu04320]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mmu05205]
Human Diseases; Cancers; Glioma [PATH:mmu05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:mmu05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mmu05220]
Human Diseases; Cancers; Renal cell carcinoma [PATH:mmu05211]
Human Diseases; Cancers; Prostate cancer [PATH:mmu05215]
Human Diseases; Cancers; Endometrial cancer [PATH:mmu05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:mmu05223]
Human Diseases; Substance dependence; Alcoholism [PATH:mmu05034]
Human Diseases; Infectious diseases; Hepatitis C [PATH:mmu05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12 C3-D; 12 28.93 cM
AA seq 1332 aa AA seqDB search
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLLDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKLKA
CSEEQEDKECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDACEYRHAFELVSKDENSVIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPDMYRFVVTDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLNLLIERFEIPEPEPTEADKLA
LEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHYYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESSPPPVEWHISRTGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
DAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPHSKTFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDALNSKGAVKSDDDPPAIPPRQPPPPKVKPRVPVLMGTFDGPV
PSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSPS
TPPTTPSPRIPRSCHLLSSSHSSLAHLPAPPVPPRQNSSPLLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagaaaacagcccgaaatggcgg
ggactattggtcccggccctgcggaaggttcaggagcaagtacatcccaccctctcagct
aatgaagagtctctctattatattgaagaactgatttttcagctgcttaataagctatgc
atggctcaaccaaggactgttcaagatgttgaggaacgagttcaaaagacctttcctcat
cctattgataaatgggcaattgctgatgcacaatctgctatagagaaacgaaaacgaaga
aatcctctcttactacctgtggacaaaatccatccttccttgaaggaagttttggggtat
aaagtggactaccatgtgtccctctacattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcaa
gacattaaagtgtccatgtgtgcagataaggttttgatggacatgttcgatcaggatgat
gatataggcttggtttctctctgtgaagatgagccttgttcttctggtgagctaaactat
tatgacctcgtcaggactgaaattgcagaagaaagacagtatctacgggagctgaatatg
atcattaaagtgttccgggaagcctttctcttggacagaaagttgttcaagccttctgaa
attgaaaagattttcagtaacatttcagatatacatgaattgactgtgaaacttttaggt
ttaattgaagacacagtagaaatgacagatgaaagtagtcctcatccattagctggtagc
tgttttgaagatttagcagaggagcaagcgtttgatccctatgaaacattatcacaggac
attcttgcaccagagtttaatgaccacttcagcaagttgatggccagacctgcagtcgct
ctacattttcagtccattgctgacggctttaaggaggctgttcgttatgtccttccacgc
ctcatgctggttcccgtgtatcactgttggcattactttgaattattaaagttgaaggca
tgcagtgaagagcaggaggacaaagagtgcttgaatcaggctataactgccctcatgaac
ctccaaggcagcatggaccgcatttacaagcagcactcccccagacgccggcctggggat
ccagtttgccttttttacaatcgtcaattaagaagcaaacacctggctatcaaaaaaatg
aatgaaattcagaaaaacatagatgggtgggaaggcaaagatatcggacagtgttgtaat
gagttcataatggaggggccactgaccagaattggtgctaaacacgaaaggcatatcttt
ctctttgatggcttaatgatcagctgtaaacccaatcatggccagacccggcttccagga
tatagcagtgcagaatacagattaaaggagaagtttgtcatgaggaaaattcaaatctgt
gataaggaagacgcctgtgagtacagacatgcttttgaattagtgtccaaagatgaaaac
agtgtaatatttgctgccaaatcagctgaagagaaaaacaactggatggcagccctcatt
tccctgcactatcgcagcactctagacagaatgctggactctgtgctgctgaaagaagag
aatgagcagcccctgaggctacccagtccagatatgtatcgctttgtggtaacagactct
gaggaaaacattgtgtttgaagacaacttgcaaagcagaagtgggatccccataattaaa
ggaggcactgtggtgaagttgatcgaaaggctaacataccacatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaaac
ttgctgatagaacggtttgaaattccagaaccagaacctactgaggcagacaagctggcg
ttagaaaaaggcgagcagccaatcagcgcagatctgaaaagattccgcaaggaatacgtc
caacctgtgcagcttagggtcttgaatgtctttcgccactgggttgagcatcattattat
gactttgaaagagacttggaactgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagccatgaagaaatgggtagaatccattgctaaaataatcaagaggaagaagcaa
gctcaggcaaatggaataagccataatatcacctttgaaagttcccccccaccagtggaa
tggcacatcagtagaacaggacagttcgaaacatttgaccttatgacacttcatccaata
gagatcgcacggcagctaacacttttggaatctgacctctacaggaaagtccagccctct
gaacttgtagggagtgtctggaccaaagaagataaagaaataaattctccaaacttatta
aaaatgattcgccatacaacaaacctcaccctatggtttgagaaatgcattgtggaagca
gaaaactttgaagaacgggtggcagtgctcagcagaatagtagaaattctgcaagtattt
caagacttgaataatttcaatggcgtgttggagatagtgagtgcagtcaactccgtgtca
gtgtacaggctagaccacacgtttgaggcactgcaggaaaggaagcggagaattttggat
gacgctgtggaactaagtcaggaccactttaaaaagtacctagtaaaacttaagtcaatc
aatccgccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaacagtgactttctaaagaggaaagggaaagatttgatcaatttcagtaagaggagg
aaagtggctgaaataactggagagatccagcagtatcagaaccaaccgtactgcttacgg
acagaaccagaaatgaggagattctttgaaaacctcaaccccatgggaattttatctgaa
aaagagtttacagattatttgttcaacaaatcattagaaatcgaaccccgaaactgcaaa
caaccacctcgatttcctaggaagtcaaccttttccttaaaatctcctggaataaggccc
aatgctggccgccatggctctacctcaggcacgctacgaggtcacccaacgcctctggaa
agagagccttataagataagctttagccggatcgctgagacagagctagaatcaacagtg
tctgcaccaacctcccccaacactccatccaccccaccagtgtctgcttcttcagaccac
agcgtgtttctagatgtggacctcaatagctcctgtggcagcaacaccatctttgctcca
gtcctcttgccacactcaaagactttcttcagctcatgtggaagtttacacaaactgagt
gaagagccactaattcctcctccgcttccccctcggaaaaagtttgatcatgatgctctc
aattccaagggagctgtgaaatctgatgatgaccctcctgctattccaccaagacagccc
cctcctccgaaggtaaagccaagagttcctgtcctcatgggtacatttgatgggcctgtg
cccagtccacctccacctcctccaagagaccctcttcctgatacccctccaccagttcct
cttcggcctccggaacactttataaactgtccatttaatcttcagccgcctccactgggc
catcctcacagagacccagactggctcagagacgtcagcacgtgtcctaactcaccaagc
actcctcccactacgccctctccacggattccacgcagctgtcacttgctcagctccagt
cacagcagccttgctcatcttccagctcctcctgtcccaccaaggcagaattcaagccct
ctcttaccaaagctgccaccaaagacttacaaacgggagctttcccacccgccactgtat
agactgcctctgctggaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system