KEGG   Mus musculus (mouse): 20698Help
Entry
20698             CDS       T01002                                 

Gene name
Sphk1, 1110006G24Rik, Sk1, Spk1
Definition
sphingosine kinase 1 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mmu00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:mmu04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:mmu04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mmu05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E2; 11
AA seq 382 aa AA seqDB search
MEPVECPRGLLPRPCRVLVLLNPQGGKGKALQLFQSRVQPFLEEAEITFKLILTERKNHA
RELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPGGSGNALAASV
NHYAGYEQVTNEDLLINCTLLLCRRRLSPMNLLSLHTASGLRLYSVLSLSWGFVADVDLE
SEKYRRLGEIRFTVGTFFRLASLRIYQGQLAYLPVGTVASKRPASTLVQKGPVDTHLVPL
EEPVPSHWTVVPEQDFVLVLVLLHTHLSSELFAAPMGRCEAGVMHLFYVRAGVSRAALLR
LFLAMQKGKHMELDCPYLVHVPVVAFRLEPRSQRGVFSVDGELMVCEAVQGQVHPNYLWM
VCGSRDAPSGRDSRRGPPPEEP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagtagaatgccctcgaggactgctcccacggccatgcagagtgctggtgctg
ctgaacccccagggtggcaagggcaaggctctgcagctcttccagagccgtgtgcagccc
ttcctggaggaggcagagataacctttaaactgatactcaccgaacggaagaaccatgcc
agggagctggtgtgtgcagaggagttgggtcactgggacgccctggcagtcatgtccggt
gatggtctgatgcatgaggtggtgaatgggctaatggaacggccagactgggagactgcc
atccagaaacccctgtgtagcctccctggaggctccggcaatgcgctggcagcttctgtg
aaccactatgctgggtacgagcaggtgactaatgaagacctgctcatcaactgcacactg
ctgttgtgccgccggcgcctgtcacccatgaacctgctgtccctgcacactgcttctggg
ctgcggctctattctgtgctcagtctgtcctggggctttgttgctgacgtggacctcgag
agtgagaagtacaggcgcttgggggagattcgtttcacagtgggcaccttctttcgccta
gcaagcctgcgcatctaccaaggccaactggcctaccttcctgtaggaactgtggcctct
aagagacccgcctctacactggtgcagaagggccccgtcgacacacaccttgttcctctg
gaggagccagtgccttctcattggactgtggtaccagaacaggacttcgtcctggtgctg
gtgctgctacacacccacctgagctccgagctgtttgcagcacccatgggccgctgtgag
gctggtgttatgcatctgttctacgtacgtgcgggggtgtcaagggctgcgctgctgcgc
ctcttcctggccatgcagaagggcaagcatatggaacttgactgtccatacctggttcat
gtgcccgtggttgctttccgcctggagcccaggagccagaggggcgtgttttctgtggat
ggagagctgatggtatgtgaagctgtgcagggccaagtgcacccaaactacctttggatg
gtctgtggcagcagagatgccccatccggccgggactcccggcgggggccacctccagaa
gaaccataa

DBGET integrated database retrieval system