KEGG   Mus musculus (mouse): 20775Help
Entry
20775             CDS       T01002                                 

Gene name
Sqle, AI323792
Definition
(RefSeq) squalene epoxidase (EC:1.14.13.132)
  KO
K00511  
squalene monooxygenase [EC:1.14.14.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    20775 (Sqle)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.17  squalene monooxygenase
     20775 (Sqle)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 D1
AA seq 572 aa AA seqDB search
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRHGGLLGRHQSGA
QFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSETTLTGAATSVSTSFVT
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGD
TVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAFHHGRFIMSLRKAAMAEPN
VKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKSLISSKVSV
SSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSETRVLVDIRGELPRNLREYMAE
QIYPQLPEHLKESFLEASQNGRLRTMPASFLPPSSVNKRGVLILGDAYNLRHPLTGGGMT
VALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRTHSFVVNVLAQALYELFSATDD
SLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLVLIRHFFSVAIYATYFCFKSEPWAT
KPRALFSSGAVLYKACSILFPLIYSEMKYLVH
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttttcttggcattgctaccttcacctatttttataagaaatgcggggatgtc
accctggccaacaaggagctcctgctgtgcgtgctggtgttcctgtcgctgggcctggtg
ctctcctaccgctgtcgccatcgacacgggggcctccttggccgccatcagagcggcgcc
cagttcgctgccttctcggatattctctctgctttgcctcttattggcttcttctgggcc
aagtcacctgaatcagaaaagaaagaacagctggagtccaagaagtgcagaaaagaaatc
ggtctttcagaaacgacattaacaggagcagctacctcagtgtcgacctcgttcgtgacg
gacccggaagtgatcatcgtgggatctggtgtgcttggatctgccttggcagcagttctc
tccagagatggaagaaaggtgacggtcatcgagagagatttaaaagagcccgacaggata
gttggggagctgctgcagccaggaggctaccgtgttctccaggagctgggccttggagat
acagtagaaggtctcaatgcccatcatatacatggctacatagttcatgactatgaaagc
agatctgaagttcaaattccgtacccactgtcagaaaccaaccaagtgcagagtggaatt
gcttttcaccatggccgattcatcatgagtctccggaaagcagctatggcagagcccaat
gtaaagtttatagaaggtgttgtgcttcagttactagaggaagatgatgctgtaatcggc
gtgcaatacaaggacaaggagactggggacaccaaggagctccacgccccgctcaccgtt
gttgcggatggactcttctccaagttcaggaagagcctcatctccagtaaagtctccgtt
tcttcccacttcgttggcttccttatgaaggatgcaccacagtttaaacccaattttgcg
gagcttgttctggtcaaccccagtccagttctcatctaccagatttcttccagtgaaact
agggtacttgttgatattcggggagaattgccaagaaacctaagagaatacatggctgaa
caaatttacccacagttacctgagcacctgaaggagtcatttctggaggcctctcagaat
ggtcgtctgcggaccatgccggccagcttccttcctccttcctcagtgaacaaacgaggc
gtccttattctgggagatgcgtataacctgaggcaccctcttactggtggaggaatgaca
gttgctttaaaagatataaaattgtggagacaactgttaaaagacattcctgacctttat
gatgatgctgctattttccaggccaaaaaatcattcttttggtcaagaaaaaggacccat
tcctttgttgtgaatgtattggctcaggccttgtatgaattattttcagctacagatgat
tccttgcatcagctccgaaaagcttgctttctgtattttaaacttggtggagagtgtgtg
accggtcctgttgggttgctttcaatattgtctcctcaccctctggtgttgattcgacac
ttcttttccgttgcaatctacgccacgtatttctgcttcaaatcagagccgtgggctaca
aaaccacgggcccttttcagtagcggtgctgtactgtacaaagcgtgttctatcctattt
ccactcatctattcagaaatgaagtatctggttcattga

DBGET integrated database retrieval system