KEGG   Mus musculus (mouse): 20779Help
Entry
20779             CDS       T01002                                 

Gene name
Src, AW259666, pp60c-src
Definition
(RefSeq) Rous sarcoma oncogene (EC:2.7.10.2)
  KO
K05704  
tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
Gap junction
Platelet activation
GABAergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Bacterial invasion of epithelial cells
Tuberculosis
Hepatitis B
Viral carcinogenesis
Proteoglycans in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    20779 (Src)
   04012 ErbB signaling pathway
    20779 (Src)
   04370 VEGF signaling pathway
    20779 (Src)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    20779 (Src)
  Cell motility
   04810 Regulation of actin cytoskeleton
    20779 (Src)
  Cellular commiunity
   04510 Focal adhesion
    20779 (Src)
   04520 Adherens junction
    20779 (Src)
   04530 Tight junction
    20779 (Src)
   04540 Gap junction
    20779 (Src)
 Organismal Systems
  Immune system
   04611 Platelet activation
    20779 (Src)
   04062 Chemokine signaling pathway
    20779 (Src)
  Endocrine system
   04912 GnRH signaling pathway
    20779 (Src)
   04915 Estrogen signaling pathway
    20779 (Src)
   04917 Prolactin signaling pathway
    20779 (Src)
   04921 Oxytocin signaling pathway
    20779 (Src)
   04919 Thyroid hormone signaling pathway
    20779 (Src)
  Nervous system
   04727 GABAergic synapse
    20779 (Src)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    20779 (Src)
  Development
   04360 Axon guidance
    20779 (Src)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    20779 (Src)
   05203 Viral carcinogenesis
    20779 (Src)
   05219 Bladder cancer
    20779 (Src)
  Infectious diseases
   05152 Tuberculosis
    20779 (Src)
   05100 Bacterial invasion of epithelial cells
    20779 (Src)
   05161 Hepatitis B
    20779 (Src)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    20779 (Src)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     20779 (Src)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   20779 (Src)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H1; 2 78.35 cM
AA seq 541 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADGHRGPSAAFVPPAAEP
KLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVD
VREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTF
LVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSK
HADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRV
AIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKG
ETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVL
DQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGEN
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagcggcgccgcagcctggagccc
tcggaaaacgtgcacggggcagggggcgccttcccggcctcacagacaccgagcaagccc
gcctccgccgacggccaccgcgggcccagcgccgccttcgtgccgcccgcggccgagccc
aagctcttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcggggcct
ctggcaggtggggtgaccacctttgtggccctctatgactatgagtcacggacagagact
gacctgtccttcaagaaaggggagcggctgcagattgtcaataacacgaggaaggtggat
gtcagagagggagactggtggctggcacactcgctgagcacgggacagaccggttacatc
cccagcaactatgtggcgccctccgactccatccaggctgaggagtggtactttggcaag
atcactagacgggaatcagagcggctgctgctcaacgccgagaacccgagagggaccttc
ctcgtgagggagagtgagaccacaaaaggtgcctactgcctctctgtatccgacttcgac
aatgccaagggcctaaatgtgaaacactacaagatccgcaagctggacagcggcggtttc
tacatcacctcccgcacccagttcaacagcctgcagcagctcgtggcttactactccaaa
catgctgatggcctgtgtcaccgcctcactaccgtatgtcccacatccaagcctcagacc
cagggattggccaaggatgcgtgggagatcccccgggagtccctgcggctggaggtcaag
ctgggccagggttgcttcggagaggtgtggatggggacctggaacggcaccacgagggtt
gccatcaaaactctgaagccaggcaccatgtccccagaggccttcctgcaggaggcccaa
gtcatgaagaaactgaggcacgagaaactggtgcagctgtatgctgtggtgtcggaagaa
cccatttacattgtgacagagtacatgaacaaggggagtctgctggactttctcaagggg
gaaacgggcaaatatttgcggctaccccagctggtggacatgtctgctcagatcgcttca
ggcatggcctatgtggagcggatgaactatgtgcaccgggaccttcgagccgccaatatc
ctagtaggggagaacctggtgtgcaaagtggccgactttgggttggcccggctcatagaa
gacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggaccgcccctgaa
gctgctctgtacggcaggttcaccatcaagtcggatgtgtggtcctttgggattctgctg
accgagctcaccactaagggaagagtgccctatcctgggatggtgaaccgtgaggttctg
gaccaggtggagcggggctaccggatgccttgtccccccgagtgccccgagtccctgcat
gaccttatgtgccagtgctggcggaaggagcccgaggagcggcccaccttcgagtacctg
caggccttcctggaagactactttacgtccactgagccacagtaccagcccggggagaac
ctatag

DBGET integrated database retrieval system