KEGG   Mus musculus (mouse): 207911Help
Entry
207911            CDS       T01002                                 

Gene name
Mchr1, AW049955, Gpr24, Mch1r
Definition
(RefSeq) melanin-concentrating hormone receptor 1
  KO
K04320  
melanin-concentrating hormone receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    207911 (Mchr1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Melanin-concentrating hormone
    207911 (Mchr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15; 15 E1
AA seq 353 aa AA seqDB search
MDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcaagcctcgttgctgtccactggccccaatgccagcaacatctccgatggc
caggataatttcacattggcggggccacctcctcgcacaaggagtgtctcctacatcaac
atcatcatgccttcagtgtttggtaccatctgtctcctgggcattgtgggaaactccaca
gtcatttttgccgtggtgaagaaatccaagctgcactggtgcagcaacgtccctgacatc
ttcatcatcaacctctctgtggtggatctgcttttcctgctgggcatgcctttcatgatc
caccagctcatgggtaatggtgtctggcactttggggaaaccatgtgcaccctcatcaca
gccatggacgccaacagtcagttcaccagcacctacatcctgactgctatggccattgac
cgctacttggccaccgtccatcccatctcctccaccaagttccggaagccctccatggcc
accctggtgatctgcctcctgtgggctctctcgttcattagcatcactcctgtgtggctc
tatgccaggcttatccccttcccagggggtgctgtgggctgtggcatccgcctaccaaac
ccagatactgatctttactggttcactctgtatcagtttttcctggccttcgcccttccg
tttgtggtcatcactgctgcgtacgtgaaaatactacagcgcatgacgtcttcggtggcc
ccagcctctcaacgcagcatccggcttcggacaaagagggtgacccgcacagccattgcc
atctgtctggtcttctttgtgtgctgggcgccctactacgtgctgcagctgacccagttg
tccatcagccgcccgaccctcacattcgtctacctgtacaatgcggctatcagcttgggc
tatgccaacagctgcctcaatccctttgtgtacatagtactctgtgagacctttcgaaaa
cgcttggtgctgtcggtgaagcccgcggcccaggggcagcttcgcacggtcagcaatgct
cagacagctgacgaggagaggacagaaagcaaaggcacctga

DBGET integrated database retrieval system