KEGG   Mus musculus (mouse): 20844Help
Entry
20844             CDS       T01002                                 

Gene name
Stam, STAM1
Definition
(RefSeq) signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
  KO
K04705  
signal transducing adaptor molecule
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Jak-STAT signaling pathway
Module
ESCRT-0 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    20844 (Stam)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    20844 (Stam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 A2-B
AA seq 548 aa AA seqDB search
MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAI
ELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSA
QMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIY
SPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQ
AYSQKALL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctttgccaccaaccccttcgaccaggatgttgagaaagcaactagtgagttg
aatactgctgaggactggggcctcatcttggatatttgtgataaggttggccaatctcgc
acaggacctaaagattgtcttcgttccattatgagaagagtgaaccataaagacccccat
gttgctatgcaagccttaactcttctgggagcatgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcaagagactttgctagtgaagtaagcaatgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctgatatcggcaatgatcaagaaccttaaggaacaaggtgta
acattcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctctcgta
gccaaggaccctgggactgtggctaccaaaaaggaagaagaagatttagccaaagctatt
gagttgtccctgaaggagcaaaggcagcagtcagcccccgtgtccacgctgtaccccagc
acatctaacctcctcactaaccaccagcacgaaggcaggaaagtccgcgccgtgtacgat
tttgaagccgctgaggataatgagcttacctttaaagctggagaaatcattacagtcctt
gatgacagtgatcccaactggtggaaaggtgaaacccatcaaggcgtggggctttttcct
tctaattttgtaactgcagatcttactgctgaaccagaaatgattaaaacagagaagaag
acggtacagttcaatgatgatgttcagatagagacaatagaaccagaaccagaaccagcc
tttattgatgaggataaaatggaccagttgttacagatgttgcaaagtacagatcctagt
gataatcagccagacttgccagagctgcttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactgtcagaacta
aacgtgaaggtgatggaagctctctcactgtatacgaagttaatgaatgaagacccaatg
tactctatgtatgcaaaattacagagtcagcagtactatctgcagtcgtcggctgtctct
gcttcccaggtatatccagggcctgcgcagagcggtacctacctggttgcagggagtgca
cagatgacccatctgcagagctacagccttcccccagagcagctgtcttctatcagccaa
ggagcagttccatcctctgcaaatcaagctcttcctagtcagcagacccaggcttcttac
ccgaatgcaatggttagttctgttcaaggaaattcgtatcctagccaggcttcaatatat
agtcctcctgctgctgctgctgctgccgctgctgctgctgtagtacctgttcctgtacct
gctgatgtcaccatataccagaatgcaggacctactatgtcccaggtgccaaactatact
ttaacatcatcaaccctgcctcaaacaggaggcagccaacagccacctcagccacagcaa
gcatattctcagaaggctctgctatag

DBGET integrated database retrieval system