KEGG   Mus musculus (mouse): 20849Help
Entry
20849             CDS       T01002                                 

Gene name
Stat4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  
signal transducer and activator of transcription 4
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
Hepatitis B
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    20849 (Stat4)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    20849 (Stat4)
  Infectious diseases
   05161 Hepatitis B
    20849 (Stat4)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    20849 (Stat4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 C1.1; 1 26.67 cM
AA seq 748 aa AA seqDB search
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEVASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPIQGPLEKSLQSSSVSERQRNVEHKVSAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNSILVNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLLEELQDWKK
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRQQLEKLQEQSTKMTYEGDPIPAQRAHL
LERATFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSSEESSNGSLSVEFRHLQPKEMKCSTGSKGNEGCH
MVTEELHSITFETQICLYGLTINLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSVTLGQLLEVMSWQFSSYVGRGLNSEQLNMLAEKLTVQSNYNDGHLTWAKFCK
EHLPGKTFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDQSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPQSPSDLLPM
SPSAYAVLRENLSPTTIETAMNSPYSAE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacaattagaaatcaagtttttggagcaagtagatcag
ttctatgatgacaactttcctatggaaatccggcatctgctagctcagtggattgagact
caagactgggaagtagcttctaacaatgaaactatggcaacaattctgcttcaaaactta
ctaatacaattggatgaacagttggggcgtgtttccaaagaaaaaaatctgctattgatt
cacaatctaaagagaattagaaaagttcttcagggcaagtttcatggaaatccaatgcat
gtagctgtggtaatttcaaattgcttaagggaagagaggagaatattggctgcagccaac
atgcctatccagggacctctggagaaatccttacagagttcttcagtttctgaaagacaa
aggaatgtggaacacaaagtgtctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagacctgcaagatgagtttgactacaggtataaaacaattcagaca
atggatcagggtgacaaaaacagtatcctggtgaaccaggaagttttgacgctgcaagaa
atgcttaatagtctggacttcaagagaaaggaagcactcagtaagatgacgcagatagtg
aacgagacagacctgctcatgaacagcatgcttctagaagagctgcaggactggaaaaag
cggcagcagattgcctgcattggtggcccgctccacaatgggctggaccagcttcagaac
tgctttaccctactggcagagagtcttttccaactcagacagcaactggagaaactacag
gagcaatctactaaaatgacctatgaaggggatcccatccctgctcaaagagcacacctc
ctggaaagagctaccttcctgatctacaaccttttcaagaactcatttgtggtcgagcga
cagccatgcatgccaacgcaccctcagaggccgatggtacttaaaaccctcattcagttc
actgtaaaactgagattactaataaaattgccggaactaaactatcaggtgaaagtaaag
gcgtccattgacaagaatgtttcaactctaagcaatagaagatttgtgctttgtggaact
cacgtcaaagctatgtccagtgaggaatcttccaatgggagcctctcagtggagtttaga
catttgcaacccaaggagatgaagtgcagtactgggagtaaaggaaacgagggctgccac
atggtgacagaggagttgcattccataacctttgagacccagatctgcctctatggcctc
accattaacctagagaccagctcattacctgtcgtgatgatttctaatgtcagccaacta
cctaatgcatgggcatccatcatttggtacaatgtatcaactaacgactcccagaacttg
gttttctttaataaccctccatctgtcactttgggccaactcctggaagtgatgagctgg
caattttcatcctatgtcggtcgtggccttaattcagagcagctcaacatgctggcagag
aagctcacagttcagtctaactacaatgatggtcacctcacctgggccaagttctgcaag
gaacatttgcctggcaaaacatttaccttctggacttggcttgaagcaatattggaccta
attaaaaaacatattcttcccctctggattgatgggtacatcatgggatttgttagtaaa
gagaaggaacggcttctgctcaaagataaaatgcctgggacatttttgttaagattcagt
gagagccatcttggagggataaccttcacctgggtggaccaatctgaaaatggagaagtg
agattccactctgtagaaccctacaacaaagggagactgtcggctctgccgttcgctgac
atcctgcgagactacaaggttatcatggctgaaaacatccctgaaaaccctctgaagtac
ctctaccctgacattcccaaagacaaagcctttggcaaacactacagctcccagccgtgc
gaagtctcaagaccaaccgaacggggagacaagggttacgtcccctctgtttttatcccc
atttcaacaatccgaagcgattccacggagccacaatctccttcagaccttctccccatg
tctccaagtgcatatgctgtgctgagagaaaacctgagcccaacgacaattgaaactgca
atgaattccccatattctgctgaatga

DBGET integrated database retrieval system