KEGG   Mus musculus (mouse): 20849Help
Entry
20849             CDS       T01002                                 

Gene name
Stat4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  
signal transducer and activator of transcription 4
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Hepatitis B
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    20849 (Stat4)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    20849 (Stat4)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    20849 (Stat4)
  Infectious diseases
   05161 Hepatitis B
    20849 (Stat4)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    20849 (Stat4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 C1.1; 1 26.67 cM
AA seq 748 aa AA seqDB search
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEVASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPIQGPLEKSLQSSSVSERQRNVEHKVSAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNSILVNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLLEELQDWKK
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRQQLEKLQEQSTKMTYEGDPIPAQRAHL
LERATFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSSEESSNGSLSVEFRHLQPKEMKCSTGSKGNEGCH
MVTEELHSITFETQICLYGLTINLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSVTLGQLLEVMSWQFSSYVGRGLNSEQLNMLAEKLTVQSNYNDGHLTWAKFCK
EHLPGKTFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDQSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPQSPSDLLPM
SPSAYAVLRENLSPTTIETAMNSPYSAE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacaattagaaatcaagtttttggagcaagtagatcag
ttctatgatgacaactttcctatggaaatccggcatctgctagctcagtggattgagact
caagactgggaagtagcttctaacaatgaaactatggcaacaattctgcttcaaaactta
ctaatacaattggatgaacagttggggcgtgtttccaaagaaaaaaatctgctattgatt
cacaatctaaagagaattagaaaagttcttcagggcaagtttcatggaaatccaatgcat
gtagctgtggtaatttcaaattgcttaagggaagagaggagaatattggctgcagccaac
atgcctatccagggacctctggagaaatccttacagagttcttcagtttctgaaagacaa
aggaatgtggaacacaaagtgtctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagacctgcaagatgagtttgactacaggtataaaacaattcagaca
atggatcagggtgacaaaaacagtatcctggtgaaccaggaagttttgacgctgcaagaa
atgcttaatagtctggacttcaagagaaaggaagcactcagtaagatgacgcagatagtg
aacgagacagacctgctcatgaacagcatgcttctagaagagctgcaggactggaaaaag
cggcagcagattgcctgcattggtggcccgctccacaatgggctggaccagcttcagaac
tgctttaccctactggcagagagtcttttccaactcagacagcaactggagaaactacag
gagcaatctactaaaatgacctatgaaggggatcccatccctgctcaaagagcacacctc
ctggaaagagctaccttcctgatctacaaccttttcaagaactcatttgtggtcgagcga
cagccatgcatgccaacgcaccctcagaggccgatggtacttaaaaccctcattcagttc
actgtaaaactgagattactaataaaattgccggaactaaactatcaggtgaaagtaaag
gcgtccattgacaagaatgtttcaactctaagcaatagaagatttgtgctttgtggaact
cacgtcaaagctatgtccagtgaggaatcttccaatgggagcctctcagtggagtttaga
catttgcaacccaaggagatgaagtgcagtactgggagtaaaggaaacgagggctgccac
atggtgacagaggagttgcattccataacctttgagacccagatctgcctctatggcctc
accattaacctagagaccagctcattacctgtcgtgatgatttctaatgtcagccaacta
cctaatgcatgggcatccatcatttggtacaatgtatcaactaacgactcccagaacttg
gttttctttaataaccctccatctgtcactttgggccaactcctggaagtgatgagctgg
caattttcatcctatgtcggtcgtggccttaattcagagcagctcaacatgctggcagag
aagctcacagttcagtctaactacaatgatggtcacctcacctgggccaagttctgcaag
gaacatttgcctggcaaaacatttaccttctggacttggcttgaagcaatattggaccta
attaaaaaacatattcttcccctctggattgatgggtacatcatgggatttgttagtaaa
gagaaggaacggcttctgctcaaagataaaatgcctgggacatttttgttaagattcagt
gagagccatcttggagggataaccttcacctgggtggaccaatctgaaaatggagaagtg
agattccactctgtagaaccctacaacaaagggagactgtcggctctgccgttcgctgac
atcctgcgagactacaaggttatcatggctgaaaacatccctgaaaaccctctgaagtac
ctctaccctgacattcccaaagacaaagcctttggcaaacactacagctcccagccgtgc
gaagtctcaagaccaaccgaacggggagacaagggttacgtcccctctgtttttatcccc
atttcaacaatccgaagcgattccacggagccacaatctccttcagaccttctccccatg
tctccaagtgcatatgctgtgctgagagaaaacctgagcccaacgacaattgaaactgca
atgaattccccatattctgctgaatga

DBGET integrated database retrieval system