KEGG   Mus musculus (mouse): 20852Help
Entry
20852             CDS       T01002                                 

Gene name
Stat6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  
signal transducer and activator of transcription 6
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
Hepatitis B
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    20852 (Stat6)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    20852 (Stat6)
  Infectious diseases
   05161 Hepatitis B
    20852 (Stat6)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    20852 (Stat6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 D3; 10 74.59 cM
AA seq 837 aa AA seqDB search
MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSAT
VQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGP
FHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQNLIDPPVNGPGPSEDLA
TMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEIMNNTVPLENSIPSNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQK
IFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNM
SQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLCSDVTMVEDSCLTQPVGGFPQGTWVSED
MYPPLMPPTEQDLTKLLLENQGEAGGSLGSQPLLQPSPYGQSGISLSHLDLRTNPSW
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggcctaatttccaagatgtccccagaaaaactgcaacggctctatgtt
gactttccacaacgcctacggcatctcctggctgactggctggagagccagccctgggag
ttcctggtcggttcagatgctttctgttacaacatggccagtgccctactttctgccaca
gtccagcgtcttcaggccactgctggagagcaggggaagggaaacagcatcttgccgcac
atcagcaccttggagagcatctatcagagggaccccctgaagctggtggccaccatcaga
caaatacttcaaggggagaaaaaagctgttatagaagagttccgccacctgccagggccc
ttccatcggaagcaggaagaactcaagtttactacagccctcggaaggcttcagcatcga
gtaagggagacccggcttctccgagaatctctgcagcaaggggctaagactggacaagtg
tctctgcagaatttgatagaccctcctgtcaatggtcctggtccaagtgaggacctggcc
accatgctgcaggggactgtgggggacctggaggccacccaggccctggtgctgaaaagg
attcagatttggaagcggcagcaacagctggcagggaatggcacaccctttgaggagagc
ctagcagggctgcaggagaggtgtgaaagcctggtggaaatttattcccagctgcagcag
gagattggggcagccagtggagaactggaacccaagacccgggcatcgctgataagccgt
ctggatgaagtcctgcgaacccttgtgaccagctctttcctggtggagaagcagcccccg
caggttctgaagacacagactaagttccaggctggggttcgattcctgctgggtctgcag
tttctagggacctcagccaagcctccaatggtcagagctgacatggtgacagagaaacag
gccagagaactaagcctggcccaggggcccgggactggagtggagagcacaggagagatc
atgaacaacacggtgcccctggagaacagcattcccagcaactgctgctccgccctgttc
aagaacctgctcctgaagaaaataaagcgctgtgagcggaagggcacagagtctgtcacc
gaggagaagtgtgctgtgctcttctccacgagcttcacattgggccccaacaaacttctc
atccagcttcaggccctgtctctgcccttggtggtcatcgtgcatggtaaccaagacaac
aacgccaaagctaccatcctatgggacaatgccttctctgagatggaccgagtgcccttt
gtggtggctgagcgagtgccctgggagaagatgtgtgaaaccctaaacctcaagtttatg
gctgaggtggggaccagccggggactgcttccagagcacttcctgttcctcgcccagaag
atcttcaacgacaacagcctcagtgtggaggcctttcagcaccgctgtgtgtcctggtca
cagttcaataaggagatcctgctgggccgaggcttcacattttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtcagatcggctgatcattggc
tttattagtaagcaatatgtcactagccttctcctcaatgagccagatgggaccttcctc
ctccgctttagcgactctgagatcgggggcatcaccattgcacacgtcatccggggtcag
gatggctcctcacagatagagaacatccagccattttctgccaaagacctgtccattcgc
tcactgggggaccggatccgggatcttgctcagttaaaaaacctctaccccaagaaaccc
aaagatgaggctttccggagtcactataagcccgaacagatggggaaggacgggaggggt
tatgtctctactactatcaagatgactgtggaaagggaccagccccttcctactccagag
ccccagatgcctgccatggtgccaccttatgatcttggaatggcccctgatgcttccatg
caactcagctcagatatggggtatcctccacagtccatccactcatttcagagcctagaa
gagtccatgagtgtactgccatcttttcaggagcctcacctgcaaatgccccccaacatg
agccagataaccatgccctttgaccagcctcacccccagggtctgctgcagtgccagtcc
caggaacatgctgtgtccagccctgaacccatgctttgctcagatgtgactatggtagag
gacagctgcctaactcagcctgtgggaggtttcccccaaggcacctgggtcagtgaagac
atgtaccctcccctgatgcctcccactgaacaggacctcaccaagcttctcctggagaac
caaggggaggcaggagggtccttaggaagccagcccctcctgcaaccatctccttatggg
caatcagggatctcactgtcccacctggacctaaggaccaaccccagctggtga

DBGET integrated database retrieval system