KEGG   Mus musculus (mouse): 20866Help
Entry
20866             CDS       T01002                                 

Gene name
Stim1, SIM
Definition
(RefSeq) stromal interaction molecule 1
  KO
K16059  
stromal interaction molecule 1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    20866 (Stim1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    20866 (Stim1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   20866 (Stim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 E3; 7 54.71 cM
AA seq 685 aa AA seqDB search
MDVCARLALWLLWGLLLHQGQSLSHSHSEKNTGASSGATSEESTEAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVIQWLITYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAERQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQLGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
GRAADEALNAMPSNGSHRLIEGVHPGSLVEKLPDSPALAKKTFMALNHGLDKAHSLMELN
PSVPPGGSPLLDSSHSLSPSSPDPDTPSPVGDNRALQGSRNTRIPHLAGKKAMAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgtgcgcccgtcttgccctgtggcttctttgggggctccttctgcatcagggc
cagagtctcagccatagtcacagtgaaaagaatacaggagctagctccggggcgacttct
gaagagtctaccgaagcagagttttgccgaattgacaagcccctgtgccacagtgaggat
gagaagctcagctttgaggccgtccgaaacatccataagctgatggatgacgatgccaat
ggtgatgtggatgtggaagaaagtgatgagttcctaagggaagacctcaattaccatgac
ccaacagtgaaacatagcaccttccatggtgaggataagcttatcagcgtggaggacctg
tggaaggcgtggaagtcatcagaagtgtacaactggactgtggatgaggtgatacagtgg
ctcattacgtatgtggagctgccacagtatgaggaaaccttccggaagttgcagcttact
ggccacgccatgccaaggctagcagtaaccaacaccaccatgacagggactgtactgaag
atgacagatcggagccacaggcagaagctgcagctgaaggccctggacacagtgctgttt
gggcctcctctcttgactcggcataatcacctgaaggacttcatgctggtggtgtctatc
gttattggtgtgggtggctgctggtttgcctatatccagaaccgttactctaaggagcac
atgaagaaaatgatgaaggatctggaagggttacaccgggctgagcagagtctgcatgac
cttcaggaaaggctgcacaaggcccaggaggagcaccgaactgtggaagtagagaaggtc
cacctggagaagaagctgcgagatgagatcaaccttgccaagcaggaagctcagcggctg
aaggagctgagggagggtactgagaatgagaggagccgtcaaaaatatgctgaggaagag
ctggagcaggttcgggaggccttgaggaaagcagagaaggagctggaatcacacagctca
tggtatgctcctgaggccctgcagaagtggctgcagctgacccatgaggtggaggtgcag
tactacaacatcaagaagcaaaatgcagagaggcagctgctggtggccaaggagggggct
gagaaaataaaaaagaagagaaacacgctttttggtaccttccatgtggcccacagctct
tccctggatgatgtggatcataaaatcctaactgctaagcaagctctgagtgaggtgaca
gcggcactgagggagcgcctgcaccggtggcagcagatcgagatcctctgcggtttccag
attgtcaataaccccggcatccactccttggtggctgctctcaacatcgaccccagctgg
atgggcagcacccgccctaaccccgcccacttcatcatgactgacgatgtggatgacatg
gatgaggagattgtgtcgcccttgtccatgcagtcccccagcctgcagagcagtgtccgg
cagcgcctgacggagccacagcttggcctgggatctcagagggatttgacccattccgat
tcggagtcctccctccacatgagtgaccgccagcgtgtggcccccaagcctcctcagatg
ggccgtgctgcagatgaagctctcaatgccatgccttccaatggcagccatcggctgatt
gagggggtccatccaggatctctggtggagaaactgcctgacagccctgctctggccaag
aagacatttatggcgttgaaccatggcctagacaaggcccacagcctgatggagctgaac
ccctcagtcccacctggtggctccccacttttggattcttcccattctcttagccccagt
tccccagacccagacacgccatctccagttggggacaaccgagctctgcagggtagccga
aacacacgaattccccacttggctggcaagaaggcaatggctgaggaggataatggttcc
attggtgaggagacagactccagtccaggcaggaagaagtttcctctcaaaatttttaag
aagcctcttaagaagtag

DBGET integrated database retrieval system