KEGG   Mus musculus (mouse): 20867Help
Entry
20867             CDS       T01002                                 

Gene name
Stip1, Hop, Sti1, p60
Definition
(RefSeq) stress-induced phosphoprotein 1
  KO
K09553  
stress-induced-phosphoprotein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Prion diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    20867 (Stip1)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Sti1 / p60
   20867 (Stip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 543 aa AA seqDB search
MEQVNELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNLQLKEGLQNMEARLA
ERKFMNPFNLPNLYQKLENDPRTRSLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLS
VLLGVDLGSMDEEEEAATPPPPPPPKKEPKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRENREDYRQIA
KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggtgaatgagctaaaggagaagggcaataaggccctgagtgctgggaacatt
gatgatgccttacagtgctactctgaggcaattaaactagatccccagaaccatgtgctc
tacagcaatcgctctgcagcctacgccaagaaaggagactaccagaaggcctatgaggac
ggctgcaagactgttgacctgaagcctgactggggcaagggttattcaagaaaagcagca
gcccttgaattcctaaaccggtttgaggaagccaaacgaacctatgaagaaggtttaaaa
catgaagccaataatctccagcttaaggagggcttgcagaacatggaggccaggttggca
gagaggaaattcatgaatccattcaacttgcctaatctataccaaaagttggaaaacgac
cccaggacaaggtcgctgctcagtgaccccacctacagggagctcatagaacagctgcag
aacaagccgtcagacctgggcacgaaactacaggatccccgggtgatgactactctgagt
gtcctccttggggttgatctgggcagcatggatgaagaggaagaggcagcaacaccccca
cccccacctcctcccaaaaaggagcccaagccagaaccaatggaagaagatcttccagag
aataagaaacaggcactgaaagagaaggagctgggaaatgatgcctacaagaagaaagat
tttgacaaggccctgaagcattatgacagagccaaggaactggaccctaccaacatgacc
tacataactaatcaagcagctgtgcactttgagaagggcgactataacaaatgccgggag
ctctgtgagaaggccattgaagtgggcagagagaaccgagaggactaccggcagatcgcc
aaagcttatgcccgaattggcaattcctatttcaaagaagaaaagtacaaggatgctata
catttctacaacaagtctctagcagagcaccgaaccccagatgtgctcaagaagtgccag
caggcagagaaaattctgaaggaacaggagcgcttggcttatatcaaccctgacttggct
ttggaggagaagaacaagggcaacgaatgcttccagaaaggggactacccccaagccatg
aagcactatacagaagccattaaaaggaacccgagagatgccaaactgtacagcaaccga
gctgcctgctacaccaagctcctggagtttcagctggcactcaaggactgtgaggagtgc
atccagctagagccaaccttcatcaagggttatacacggaaagcagctgctctggaagcc
atgaaggactatacaaaagccatggatgtgtaccaaaaagcgttagacctggactccagc
tgtaaggaagcagcagatggttaccaacgctgtatgatggcacagtacaacagacatgat
agccctgaggatgtgaagcggcgggccatggctgaccctgaggtgcagcagataatgagt
gacccagccatgagactcatcctggagcagatgcaaaaggacccccaggctctgagcgaa
cacttaaagaatcctgtaatagcgcagaagatccagaagctgatggatgtgggtctcatc
gcaattcggtga

DBGET integrated database retrieval system