KEGG   Mus musculus (mouse): 20872Help
Entry
20872             CDS       T01002                                 

Gene name
Stk16, EDPK, Krct, MPSK, PKL12, TSF-1
Definition
(RefSeq) serine/threonine kinase 16 (EC:2.7.11.1 2.7.10.2)
  KO
K08856  
serine/threonine kinase 16 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20872 (Stk16)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  NAK family [OT]
   20872 (Stk16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C3
AA seq 305 aa AA seqDB search
MGHALCVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQE
EAQREAEMHRLFQHPNILRLMAYSLKERGAKHEAWLLLPFFKKGTLWNEIERLKDQGSFL
TEDQILPLLLGISRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIQVEGS
RQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNELSIPQSPRHSSALRQLLSSMMTVDPQQRPHIPVLLSQLEALQPPAPGQ
HTTQI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgcactgtgtgtctgctcccggggaactgtcatcattgacaataagcgttac
ctcttcgtccagaaattgggggaaggtggattcagctatgtggacctagtggagggcttg
catgatggacacttctacgccctgaagcggatcctgtgccatgagcagcaagaccaggaa
gaagcccaacgagaggcagagatgcatcgcctcttccagcatcccaacatccttcgcctc
atggcttactctctgaaagaacgaggtgctaagcatgaagcctggctgctgctgcccttc
ttcaagaaaggtacactgtggaatgagatagaaaggctgaaggaccaaggcagcttcctg
actgaagaccagatcctgccgctgttgctgggtatcagcagaggccttgaggctattcat
gccaaaggttatgcacacagggacctgaagcccaccaatattttgcttggtgatgagggg
cagccagttttaatggacttgggttctatgaatcaagcatgcattcaagtggagggctct
cgccaggcactagctcttcaggactgggcagctcagcggtgcaccatctcctaccgggca
cctgaacttttttctgtgcaaagccactgtgtcatcgatgagcggactgatgtctggtcc
ctaggctgtgtgctttatgccatgatgtttggggaaggcccttacgatatggtgttccag
aagggtgacagtgtggcccttgctgtgcagaatgaactcagcatcccacaaagccccagg
cattcttcagcattgcgacagctattgtcttctatgatgactgtggacccccagcagagg
cctcacatccctgtcctcctcagtcagttggaggcattgcagccaccagctcctggccag
cacaccacccaaatctga

DBGET integrated database retrieval system