KEGG   Mus musculus (mouse): 208727Help
Entry
208727            CDS       T01002                                 

Gene name
Hdac4, 4932408F19Rik, HD4
Definition
(RefSeq) histone deacetylase 4 (EC:3.5.1.98)
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    208727 (Hdac4)
  Substance dependence
   05034 Alcoholism
    208727 (Hdac4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    208727 (Hdac4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     208727 (Hdac4)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     208727 (Hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 D
AA seq 1076 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPTAVPMDLRLDHQFSLP
LEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVATALKKRPLDVTDSACSSAPGSGPS
SPNSSSGNVSTENGIAPTVPSAPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPAT
GPAAGAAGQQDAERLALPALQQRILFPGTHLTPYLSTSPLERDGAAAHNPLLQHMVLLEQ
PPTQTPLVTGLGALPLHSQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVI
QQQHQQFLEKHKQQFQQQQLHLSKIISKPSEPPRQPESHPEETEEELREHQALLDEPYLD
RLPGQKEPSLAGVQVKQEPIESEEEEAEATRETEPGQRPATEQELLFRQQALLLEQQRIH
QLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLML
KHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLY
GTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATG
ELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDWDVHHGNGTQ
QAFYNDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLEPPMGDAEYL
AAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRL
VLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLHQRPNANAVHSMEKVMDIHSKYW
RCLQRLSSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagcctgtggagctgctg
aatcctgcccgtgtgaaccacatgcccagcacggtggacgtggctacagcgctgcctctg
caagtggcccctacagcagtacccatggacctgcgcttggaccaccagttctcactgccc
ttggaacctgcattgcgggagcagcaactgcagcaggaactcctagcactgaaacagaag
cagcagatccagcggcagatactcattgcagagttccagcgtcaacatgagcagttgtcc
cgacagcatgaggcacagttgcatgaacatatcaagcagcagcaggagatgctggccatg
aagcaccagcaggagctgctggagcaccagcggaaactggagcggcaccggcaagagcag
gagctggagaagcagcaccgtgagcagaagctgcagcagctcaagaacaaggagaagggc
aaagagagtgctgtggcgagcacagaggtgaagatgaagctgcaggagtttgttctcaac
aagaagaaggctctagcccaccggaacctgaaccactgcatttccagcgatccccgctac
tggtatgggaagacacagcacagctcccttgaccagagctctccaccccagagtggggtg
tcagcctcctacaaccaccccgtcttgggaatgtacgacgccaaagatgacttccctctt
aggaaaacagcttctgaacctaacctgaaattacgctcaaggcttaagcagaaagtagct
gagagacggagcagccccctgttgcgcaggaaagatggccctgtggccactgctctaaaa
aagcgacccctggatgttacagactccgcatgcagcagcgcccctggctccggtcccagc
tctccaaatagcagctctggcaacgtcagcactgagaatggcatcgcacccactgtgccc
agcgctccagctgagacgagcttggcacacagacttgtgactcgagaaggctcagtcgcc
ccacttcctctctacacgtcaccatccttacccaacatcaccttgggacttcctgccact
ggccctgccgctggtgcggcaggtcagcaggatgctgagaggcttgctctcccagctctc
cagcagcggatcttgttccctgggacccacctcaccccgtacctgagcacctcgcccctg
gagagggacggtgcagcagctcacaaccccctcctgcagcacatggtcctgctggagcag
ccacccacccagacaccccttgtcacaggcctgggggcgctgcccctccactcacagtcc
ctggttggtgcggacagggtgtccccatccattcacaagctgcggcagcaccgccctctg
gggcgcacgcagtcagcacccctgccgcagaacgcacaggccctgcagcacctggtgatc
cagcagcagcaccagcagttcctggagaagcacaagcaacagttccagcagcagcagctg
cacctcagcaagataatctccaaacctagtgagccacctcggcagcctgagagccaccca
gaggagacagaggaggagctccgtgagcaccaggccttgctggatgagccctacctagat
cggctacctgggcagaaggagccctccctggctggtgtgcaggtgaagcaggagcccatt
gagagtgaggaggaagaagcggaggccactcgagagacagagcccggccagcgcccagcc
actgagcaggagctgctcttcagacagcaagccctcctactggagcagcagaggatccac
cagttaagaaactaccaggcatctatggaggctgctggcatccctgtgtcatttggcagc
cacagacctctgtctcgggcacagtcctccccagcatctgccaccttccccatgtcagtc
caggagccccccaccaagccaaggttcaccacaggtcttgtgtatgacacactgatgttg
aagcatcagtgcacctgtgggaacaccaacagccacccggagcatgctgggaggatccag
agcatctggtcccgcctgcaggagactggactccgtggcaagtgtgagtgcatccgtgga
cgcaaggccacattggaggagctgcagacagtgcactcggaggcccacacactcctctac
ggcacaaatcctctcaacagacagaaactggacagctcgctgacctcagtgttcgtcagg
cttccttgtggtggtgttggggtggatagcgacaccatatggaatgaggtgcactcgtct
ggggcagcccgcctggctgtaggctgtgtagtggagctggtcttcaaggtggccacggga
gagctaaagaatggctttgctgtggttcgtcccccaggacaccatgccgaggagagcaca
cccatgggtttctgctactttaactccgtggcagttgcagccaaacttctccagcagagg
ctgaatgtgagcaagatcctcattgtagactgggatgtacatcatgggaatgggacccag
caggccttctacaatgaccccaatgttctctacatgtccctgcaccgctatgacgatggg
aacttcttcccaggaagtggagcaccagatgaggtgggcacagggccaggcgtgggtttc
aatgtcaacatggctttcacgggtggcctcgaaccccccatgggagacgctgagtacttg
gcagccttcagaacggtggttatgcctatcgcaaatgagtttgccccagatgtggtactg
gtgtcatcgggcttcgatgctgtggagggccaccccacacctcttggagggtacaatctc
tctgccaaatgttttgggtacttgacaaaacagctgatgggcttagctggtggccggctt
gtgctggcccttgagggaggccatgacctgacagccatctgtgatgcttctgaagcctgc
gtgtctgctctgctgggaaacgagcttgagcctctgccagaaaaggttctacatcagaga
cccaatgccaatgctgtccactccatggagaaagtgatggacatccacagcaagtactgg
cgctgcctgcagcgtctgtcctccacggtggggcactctctgattgaggcgcaaaagtgt
gagaaggaagaagctgagacagtcaccgccatggcctcgctgtctgtaggcgtcaaacct
gctgagaagagatctgaggaggagcccatggaggaggaaccaccactgtag

DBGET integrated database retrieval system