KEGG   Mus musculus (mouse): 20877Help
Entry
20877             CDS       T01002                                 

Gene name
Aurkb, AIM-1, AIRK2, AL022959, Aik2, Aim1, Ark2, AurB, IPL1, STK-1, Stk12, Stk5
Definition
(RefSeq) aurora kinase B (EC:2.7.11.1)
  KO
K11479  
aurora kinase B [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20877 (Aurkb)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   20877 (Aurkb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20877 (Aurkb)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     20877 (Aurkb)
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     20877 (Aurkb)
  Sister chromatid separation proteins
   Aurora kinases
    20877 (Aurkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 42.32 cM
AA seq 345 aa AA seqDB search
MAQKENAYPWPYGSKTSQSGLNTLSQRVLRKEPATTSALALVNRFNSQSTAAPGQKLAEN
KSQGSTASQGSQNKQPFTIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEK
EGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQ
RTATIMEELSDALTYCHKKKVIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCG
TLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSS
VPSGAQDLISKLLKHNPWQRLPLAEVAAHPWVRANSRRVLPPSAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaaggagaacgcctacccgtggccctacggctcaaagacgtctcagtctggc
ctgaacacgttgtcccagagagtcctacggaaggagcccgccacgacatctgcgcttgct
ctcgtgaaccggttcaacagccagtccacagctgcccctggccagaagttggctgagaac
aagagtcagggctccactgcctcgcaaggatcccagaacaagcagcctttcactattgac
aactttgagattgggcgtcctttgggcaaaggcaaatttggaaacgtgtacttggctcgg
gagaagaagagccgtttcatcgtggcactcaagatcctcttcaagtctcagattgagaag
gagggggtagagcaccagcttcgccgagagatcgaaatccaggcgcacctgaaacatccc
aacatccttcaactctacaactacttctacgaccagcagaggatctacttaatcctggaa
tacgcccctcgcggggaactctacaaggaactgcagaagagtcggaccttcgatgagcag
cggactgccacgatcatggaggaactgtcagatgccctgacctactgccacaagaagaag
gtaattcacagagacataaagccggagaacctgctgttaggtctgcagggagaactgaag
attgcagactttggctggtcggtgcatgccccatccctgaggaggaagaccatgtgcggc
acgctggactatctgcccccagagatgattgaggggcgcatgcataatgaaatggtagat
ctatggtgcatcggggtgctctgctatgaactgatggtggggaacccacccttcgagagc
cctagccacagtgagacgtatcgtcggattgtcaaggtggacctgaagttcccctcttct
gtgccttcgggcgcccaggacctcatctccaagctgctcaaacataacccctggcaacgg
ctgcccctggcggaggttgcagctcacccttgggtccgggccaactcaaggagggttctg
cctccctctgccctttag

DBGET integrated database retrieval system