KEGG   Mus musculus (mouse): 20878Help
Entry
20878             CDS       T01002                                 

Gene name
Aurka, AIRK1, ARK-1, AU019385, AW539821, Ark1, Aurora-A, Ayk1, IAK, IAK1, Stk6
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    20878 (Aurka)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20878 (Aurka)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   20878 (Aurka)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20878 (Aurka)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    20878 (Aurka)
   Spindle formation proteins
    20878 (Aurka)
  Sister chromatid separation proteins
   Aurora kinases
    20878 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 H3; 2 94.84 cM
AA seq 395 aa AA seqDB search
MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQ
KLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWT
LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLR
HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS
KRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEK
VDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNAS
QRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctccaggcctgttaagaccactgttcccttcggt
ccgaaacgcgtcttggtgactgagcagattccgtctcagaacctaggatctgctagcagt
ggccaggcccagcgggtcctgtgtccttctaactcccagcgtgtcccttcacaagcccag
aaacttggagcaggtcagaagccggcaccaaagcagttgccagctgccagtgttcctagg
cctgtgtcccggctcaataacccccagaagaatgagcagcctgcagcctccggaaatgat
tctgaaaaggagcaggcatccttgcagaagaccgaagacacaaaaaaaaggcagtggact
ttggaagattttgacattggccgcccactaggaaaagggaagtttggaaatgtctacttg
gcgcgggagagacaaagcaagttcatcctggctctgaaggtgctgtttaaaacacagctg
gagaaggcgaacgtggagcaccagcttcggagagaggtggagatccagtcgcacctgcgg
caccccaacatcctcaggctgtatggctatttccatgacgccacccgagtttatctgatt
ctagaatatgcgccccttggaacagtctatagagagctccaaaaactctccaagtttgac
gagcagagaacagctacttacatcactgagttggcaaacgctctgtcttactgtcattca
aagagagtgatccacagagacattaagccagagaacttactgcttggctcaaacggagag
ttgaagattgcagacttcgggtggtcggtgcatgctccatcttccaggagaaccacaatg
tgtggcaccctggactacctgcccccagagatgattgaaggccggatgcatgacgagaag
gtggacctctggagcctcggcgttctctgctatgagttcctagtggggatgcctcctttc
gaggcacacacgtaccaggagacttacagaaggatatctcgggttgaattcactttccct
gactttgtgacagagggagccagggacctcatttcaagactgttaaaacacaacgcaagc
caaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattcttccaaa
cctccaactggccacactagcaaagagccaaccagcaaatcatcttag

DBGET integrated database retrieval system