KEGG   Mus musculus (mouse): 20878Help
Entry
20878             CDS       T01002                                 

Gene name
Aurka, AIRK1, ARK-1, AU019385, AW539821, Ark1, Aurora-A, Ayk1, IAK, IAK1, Stk6
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    20878 (Aurka)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20878 (Aurka)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   20878 (Aurka)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20878 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 H3; 2 94.84 cM
AA seq 395 aa AA seqDB search
MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQ
KLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWT
LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLR
HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS
KRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEK
VDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNAS
QRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctccaggcctgttaagaccactgttcccttcggt
ccgaaacgcgtcttggtgactgagcagattccgtctcagaacctaggatctgctagcagt
ggccaggcccagcgggtcctgtgtccttctaactcccagcgtgtcccttcacaagcccag
aaacttggagcaggtcagaagccggcaccaaagcagttgccagctgccagtgttcctagg
cctgtgtcccggctcaataacccccagaagaatgagcagcctgcagcctccggaaatgat
tctgaaaaggagcaggcatccttgcagaagaccgaagacacaaaaaaaaggcagtggact
ttggaagattttgacattggccgcccactaggaaaagggaagtttggaaatgtctacttg
gcgcgggagagacaaagcaagttcatcctggctctgaaggtgctgtttaaaacacagctg
gagaaggcgaacgtggagcaccagcttcggagagaggtggagatccagtcgcacctgcgg
caccccaacatcctcaggctgtatggctatttccatgacgccacccgagtttatctgatt
ctagaatatgcgccccttggaacagtctatagagagctccaaaaactctccaagtttgac
gagcagagaacagctacttacatcactgagttggcaaacgctctgtcttactgtcattca
aagagagtgatccacagagacattaagccagagaacttactgcttggctcaaacggagag
ttgaagattgcagacttcgggtggtcggtgcatgctccatcttccaggagaaccacaatg
tgtggcaccctggactacctgcccccagagatgattgaaggccggatgcatgacgagaag
gtggacctctggagcctcggcgttctctgctatgagttcctagtggggatgcctcctttc
gaggcacacacgtaccaggagacttacagaaggatatctcgggttgaattcactttccct
gactttgtgacagagggagccagggacctcatttcaagactgttaaaacacaacgcaagc
caaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattcttccaaa
cctccaactggccacactagcaaagagccaaccagcaaatcatcttag

DBGET integrated database retrieval system