KEGG   Mus musculus (mouse): 208898Help
Entry
208898            CDS       T01002                                 

Gene name
Unc13c, 1500037O19Rik, AU019458, D9Ertd414e, Munc13-3, Unc13h3
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mmu  Mus musculus (mouse)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    208898 (Unc13c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 D; 9 40.8 cM
AA seq 2210 aa AA seqDB search
MVASLFKSLILAYIHKLCKGMFTKKLGNTTKKKENRQQKKDQDFPTAGHTKPPKLSNALK
STVKKIAKCSSTRNFSIEDEEGHKDFSLSPTFSYRVAIANGLQTAVTNSDEDLLQELSSI
ESSYSESFNELRSSTENQVQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHTLKLGALRK
LRKWKKSQECVSSDSELSTVKKTWGIRSKSLDRTARNPKTNVLEPGFSSSGCISQTHDVM
EMIFKELQGISQIETELSELRGHVNALKYSIDEISSSVEVVQSEIEQLRTGFVQARRETR
DIHDYIKHLGHMGSKVSLRFLNVPEERHEYVESVVYQILIDKMGFSDVPNAIKIEFAQRI
GQQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTYDIRERKEKGVLP
SSQTYESMDMKLSTPEPKAKKNAWLSPNDSDRELESDLSRSSYADSPAKGSSSKSSSKSH
SARSKNKAANSRTSQKSDYNKRPSQPPASSTPEKQTPHYVEATPPLWHSQSDFFTLKLSR
SESDFSKLCQSYSEDFSESQFFCRTNGSSLLSSSDRELWQRKQEGMPALYHRLQDQGLDE
TIPAVPGQAEIENTETVDSGMSNSMVCASGDRSNYSGSQLSLHEDLSPWKEWNQAGQGTD
DVGLDSSTQEPFDYDTNSLSDQQLDLSSKDLDDLGKCHSDLQDDSESYDLTQDDNSSPCP
GLDNEPQGQWVGQYDSYQEANSNDLYPNQSHPSMMYRSQSELQSDDSEGAQPKSWHSRLS
IDLSDKTFKFPKFGSTLQRAKSALEVVWNKSTQSLSGCEDSGSSLMGRFRTLSQSTANES
STTLDSDIYTEPYYYKAEEEEDYCEPVADSETDYVEVMEQVLAKLENRTSITEVNEHIKD
YDHPSYETPYETPQDEGYDGQADDIISEGELETLNEPAVEMELAEDENQNLPAESLEVMK
PKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSMDEKARIVSGNDLDASKFSALQVFGG
AGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHVFRKT
LQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQISKEDFVQYT
KAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLN
PVWDEKFFFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMD
VWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSNGSVK
IPEVKGDEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTHFSCLSSKYMCPGVPAVMSAL
LANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRENFPAS
NSERLQDLKSTVDLLTSITFFRMKVLELQSPPKASAVVKDCVRACLDSTYKYIFDNCHEL
YSQLIDPSKKQDVPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQELNMG
KISAEIMWSLFALDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPE
YSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFAQLNQSF
EIIKKLECPNPEALSHLMRRFAKTINKVLVQYAAIVSNDFSSYCDKETVPCILMNNIQQL
RVQLEKMFESMGGKELDPEASTILKELQIKLNGVLDALSITYGESFQLTIEECIKQMGAE
LNQMRANGNSTANKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLVL
NKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAIVEVVLAT
IKQYFHAGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALIKKFIETQGSQSRSSKDAVG
QISVHVDVTTTPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCMLGPSLGDKKRKQGTK
TKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGS
YGAWYPLLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIEESA
NT seq 6633 nt NT seq  +upstreamnt  +downstreamnt
atggtggccagtctctttaagagcttgattttagcttatatacataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaagaaagagaatcgtcagcagaaaaaa
gatcaagattttccaactgctggccacaccaaaccccctaaattgtcaaatgccctgaaa
agcactgtaaaaaagattgcaaagtgctcatctacccggaacttctccatagaagacgaa
gagggtcacaaagacttctccctgtcacccacattcagttaccgagttgctatcgccaat
ggcctgcaaacagccgtgaccaacagcgatgaggatctgctccaggagctgtcttccatc
gagagctcgtactctgaatccttcaatgagctaaggagcagcacggaaaaccaggtccaa
tcaacacacaccatgcctgtccgacgtaacaggaagagctcgagcagtttggcaccttct
gagggcagctcagatggggagcgcaccctccacaccttaaaactgggtgctctacggaaa
ctgaggaaatggaagaagagccaagagtgcgtctcctcagactcggagttgagcaccgtc
aagaaaacctggggcataagaagcaaatcattagatagaactgcccggaacccaaagaca
aatgtcttagagccagggttcagctcctctggctgcattagccaaacccacgatgtcatg
gaaatgatctttaaagagcttcagggtataagtcagatcgaaacagaactttccgaactc
cgagggcacgtgaatgctctcaagtactctatcgatgaaatctccagcagtgtggaggta
gtccagagcgagatcgaacagcttcgaacagggtttgtccaggctcgaagggaaactcga
gacatccacgattacattaaacacttgggtcacatggggagtaaggtaagcctgagattt
ttaaatgtgcctgaagaaagacacgagtacgtggaaagtgtggtgtaccaaattcttata
gataaaatgggtttctcagatgtaccgaatgctattaaaattgaatttgctcagaggata
gggcagcaaagggactgcccaaatgcaaaacctcgacccatcctagtgtactttgaaacc
cctcagcaaagggattctgtcttaaagaaatcgtataagctgaaaggtacaggcatcggg
atctccacagatattctaacttatgatatcagagaacggaaagaaaaaggggtattgcca
tcttcccagacatacgaaagcatggatatgaagttatccacgccagagcccaaagccaag
aagaacgcttggctgtcacccaatgacagtgacagagagctggagtcagacctcagcaga
agcagctatgctgactctccggcaaagggaagttcttctaaatccagctcaaagtcacac
agtgctcggtccaagaacaaagcagctaacagcagaacatcacagaagtcagactacaat
aaacggccctcccaaccgccagcatcaagtaccccagaaaagcaaacacctcactatgtg
gaggccacaccaccactctggcattcacagagtgacttcttcactcttaaacttagtcgc
tccgaatcggatttctccaaattgtgtcaatcttattcagaggatttttctgaaagccag
tttttctgtcgaactaatgggagctccctcctttcctcgtctgaccgggaactttggcag
aggaaacaggagggcatgcctgccttgtaccaccgtcttcaggaccagggtttggatgag
actattccagcagtgccagggcaggctgaaattgagaatacagaaacagtagacagcggt
atgagcaacagcatggtgtgtgcatctggagaccgaagcaattacagcggttctcagctc
tcattgcacgaggacctgtctccatggaaggagtggaatcaagcagggcaaggaactgat
gatgttggcttagattcatctacccaggaaccttttgactacgataccaacagtttgtct
gaccaacagctggatctctctagcaaagacctagatgaccttggcaagtgccacagcgac
ctgcaagatgactctgaaagctatgatttaacccaggatgacaactcctctccatgccct
ggattggataatgaaccacaaggccagtgggttggccagtacgactcttatcaggaagcc
aattctaatgacctgtatcccaaccaaagccatccatccatgatgtatagaagtcaaagc
gaactgcaaagtgatgattcagagggggcccagcccaagtcctggcacagtcggctaagc
attgacctttctgataagacttttaagttccccaaatttggatctactcttcagagagca
aagtcagccctggaagtggtgtggaacaagagcacacagagtctcagtgggtgtgaggac
agcggctcttccttaatggggagatttcggacattatcacaatccaccgcgaacgagtca
agtaccacccttgactctgatatctacacggaaccctattactataaagccgaggaagag
gaggactactgtgaaccagtggctgacagtgagacagattatgttgaagtgatggagcag
gtcctagctaagctagaaaacaggactagtatcactgaagtaaacgaacacattaaagac
tatgaccacccttcctatgaaactccttacgagaccccgcaagatgagggctatgatggg
caggctgatgacatcattagtgaaggagaactggaaaccttaaatgaaccagcagttgaa
atggaattagcagaagatgagaaccaaaacctccctgcagagtcactggaggtcatgaag
ccaaagagaatcaggccttccttcaaagaagcagctttaagggcctataagaagcagatg
gcagagctggaagagaagatcctggctggagatagcagctctatggatgaaaaggctcga
atagtaagtggcaatgatttggatgcttccaaattctccgcactccaggtgttcggtggg
gctgggcgtggactgtatggtattgatagcatgcctgacctccgcaggaaaaagacattg
cctattgtgcgggatgtggccatgaccctggctgcccggaaatctggtctctcccttgct
atggttatcaggacatcactgaataatgaggagctgaaaatgcatgtcttcaggaagacc
ttgcaggcattgatctaccccatttcttccaccactccccacaacttcgaggtctggacg
gctaccacacccacctactgctatgaatgtgaagggctcctgtggggcatcgcaaggcaa
ggcatgaagtgtctggagtgtggggtgaaatgccacgagaagtgtcaggacctgctcaac
gccgactgtctgcagcgagcagcagagaagagctctaagcacggtgcggaggacaagacc
cagactatcatcacagccatgaaagaaagaatgaagatcagggagagaaacagaccagag
gtgtttgaagtcattcaggaaatgttccagatctccaaagaggattttgtgcagtacaca
aaggctgccaagcagagcgtgctggatgggacgtcgaagtggtctgcaaaaattaccatt
acagtggtttccgcacaaggcttgcaggcaaaagacaaaacagggtccagcgacccatat
gtgacagttcaagttggcaaaaataaaagaagaacgaaaactatctttggaaacttgaat
ccagtgtgggacgagaagttcttctttgagtgtcataactcgacagatcgaatcaaggtc
agagtatgggatgaagatgatgacattaaatccagagttaagcagcacttcaagaaggag
tcggatgactttctgggacagacgattgtggaagtcaggactctaagtggtgagatggat
gtctggtacaacttagagaaacggacagataagtcagctgtgtctggggccatccgacta
aaaatcaatgtggagataaagggagaagagaaggtcgcaccataccatatacaatacact
tgtttacacgagaacctgttccattacctgacggaagtgaagtctaatggcagtgtaaaa
ataccagaggtcaagggcgatgaagcctggaaggttttctttgatgatgcgtctcaggaa
atagtggatgaatttgccatgcgttatggggttgagtccatttatcaagctatgacgcac
ttttcatgtctgtcttctaagtacatgtgcccgggtgtccctgcagtcatgagcgccctg
ctggcgaacatcaatgccttctatgctcatacaactgtctccactaacgtgcaggtttct
gcctctgatcgctttgctgctacaaactttgggagggaaaaattcataaaactactggac
cagttgcataactccttaaggattgacctgtcaaagtacagggaaaactttccagccagc
aacagtgagagactacaggacctaaagtccactgtggacctgttgaccagcatcaccttc
ttccggatgaaggtcctggagctgcagagccccccaaaggccagtgcagttgtgaaggac
tgtgtcagggcttgtctggattccacatacaagtatatcttcgacaactgccatgaactc
tattctcagctgatagacccgagcaagaagcaggatgtccctcgagaagaccagggacca
accaccaagaacctggacttctggccacagttgattacactgatggtcactattattgat
gaggataaaactgcctacacccctgttctcaatcagtttccacaagaactaaacatgggg
aagataagtgcagaaatcatgtggtctctttttgctctcgatatgaaatatgctctagag
gaacatgagaagcaacgcttatgcaagagcaccgattatatgaatttgcatttcaaagtg
aaatggttttataatgagtatgtacgagaacttcctgccttcaaggatgctgttccagaa
tattccctgtggtttgagccttttgttatgcaatggctagatgaaaatgaagatgtgtcc
atggagttccttcatggagcactgggaagagacaaaaaagatggattccagcagacatcg
gaccacgcccttttctcctgttctgtggttgatgtctttgctcagcttaaccagagcttt
gagatcattaagaaactggaatgccccaatcctgaagccctatcacacttaatgagacga
tttgcaaagaccatcaataaggttctggtccagtacgctgcgatcgtatcaaatgacttc
agttcatactgcgataaggagacagtgccttgcatattgatgaacaacatccaacaactg
cgggtccagctggaaaaaatgtttgaatccatgggtgggaaagagctagaccctgaagct
agcactattctgaaagaacttcaaatcaaactcaacggggttctggatgcactcagcatc
acttatggagaaagtttccaacttacaattgaagagtgtataaagcagatgggtgccgag
ctgaatcagatgcgagccaacgggaacagcacagcgaataagaacagtgcggcgatggat
gcagagattgtgctgaggccgctcatggacttcttggataagacattaagtctttcagca
aaaatttgtgagaaaacggtcctgaagcgagttctgaaggagctctggaaattagtactt
aacaagatagagaagcagattgttctccctccactgacagaccaaacggggcctcagatg
atcttcattgctgctaaagatcttggacagttatccaaactgaaggagcatatgattcga
gaagatgccaagggtctgacaccaagacaatgtgcaatagtggaggtggtcttggccact
ataaagcaatattttcatgcaggaggaaatggcctgaagaagaattttctggagaaaagc
ccagatcttcattccctgagatacgctctcagcctctacacacaaactactgatgctttg
atcaagaagttcatagagacacagggctcacagagtcgttcctccaaagatgctgtaggc
cagatctctgtccatgtggatgtcaccaccaccccagggactggagaccataaagtcact
gtgaaagtaattgcgatcaatgacctaaactggcagaccaccgccatgttccgccccttt
gtggaagtgtgcatgctgggacccagcctaggggacaagaagagaaaacaagggacaaag
acaaaaagcaacacatggtcaccgaagtacaatgaaaccttccagttcattctgggtaac
gagaaccgcccaggagcctatgaacttcacctctcggttaaggactactgctttgcccga
gaagatcgaataattggaatgacagtcattcagttacagaacatagcagagaaagggagc
tacggggcatggtaccctcttctgaaaaatctctctatggatgaaactggtttaaccatc
ctcagaatactctctcagaggaccagcgacgatgtcgctaaagagtttgtgagacttaag
tcagaaacgaggtctattgaagagagtgcctga

DBGET integrated database retrieval system