KEGG   Mus musculus (mouse): 209176Help
Entry
209176            CDS       T01002                                 

Gene name
Ido2, AI265623, C230043N17Rik, Ido-2, Indol1
Definition
indoleamine 2,3-dioxygenase 2 (EC:1.13.11.52)
Orthology
K00463  
indoleamine 2,3-dioxygenase [EC:1.13.11.52]
Organism
mmu  Mus musculus (mouse)
Pathway
Tryptophan metabolism
Metabolic pathways
African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    209176 (Ido2)
 Human Diseases
  Infectious diseases
   05143 African trypanosomiasis
    209176 (Ido2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.52  indoleamine 2,3-dioxygenase
     209176 (Ido2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A2; 8
AA seq 405 aa AA seqDB search
MEPQSQSMTLEVPLSLGRYHISEEYGFLLPNPLEALPDHYKPWMEIALRLPHLIENRQLR
AHVYRMPLLDCRFLKSYREQRLAHMALAAITMGFVWQEGEGQPQKVLPRSLAIPFVEVSR
NLGLPPILVHSDLVLTNWTKRNPEGPLEISNLETIISFPGGESLRGFILVTVLVEKAAVP
GLKALVQGMEAIRQHSQDTLLEALQQLRLSIQDITRALAQMHDYVDPDIFYSVIRIFLSG
WKDNPAMPVGLVYEGVATEPLKYSGGSAAQSSVLHAFDEFLGIEHCKESVGFLHRMRDYM
PPSHKAFLEDLHVAPSLRDYILASGPGDCLMAYNQCVEALGELRSYHINVVARYIISAAT
RARSRGLTNPSPHALEDRGTGGTAMLSFLKSVREKTMEALLCPGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcaaagtcagagcatgacgctggaggtgccgttgtccttggggagataccac
atttctgaggaatatggctttctccttccaaatcctctggaagcacttccagatcattac
aagccttggatggaaattgccctcagacttcctcacttaatcgagaaccgccagctccga
gctcacgtgtacaggatgcctctcctggactgcagattcctaaagagttaccgtgagcag
cgcctggcacacatggcgctggccgctatcaccatgggattcgtctggcaggagggggaa
ggccaaccccaaaaggtgctgccaagatctcttgccattccttttgttgaggtatccagg
aacttgggactcccgcctatcctggtccactctgacctggtgctgacaaactggaccaaa
aggaacccagaaggaccgttggaaatcagtaacctggaaaccatcatctcatttccgggg
ggagagagcctgcggggcttcatcctagtgacagtcttggtggagaaggcagcagtgccc
ggccttaaggccctggttcagggaatggaggccattcggcaacacagtcaggacaccctg
ctagaagccctgcagcagctgagactctccatccaggatatcaccagagccttggcccaa
atgcatgattatgtggacccagacatattttactcggtcatccggatcttcctctctggg
tggaaggacaatccagccatgcctgtggggctggtctatgaaggtgttgccacagagcct
ctgaagtactctggaggaagtgcagcccagagctccgtgcttcatgccttcgatgagttc
ctgggcattgagcattgcaaggaaagtgttggctttctacacagaatgagggactacatg
ccgccttcccataaggctttcctggaagatctccacgtagctccttctctgagagactac
atactggcctctggtcctggggactgcctgatggcctataaccagtgtgtggaggccctg
ggagagctgcgcagttaccacatcaatgtcgtggccagatacattatctccgctgccacc
agggccaggagcagggggctaactaatccctcaccccatgccttggaagacaggggcact
gggggtactgccatgctgagcttcttgaagagtgtcagggagaagaccatggaggccctc
ctgtgtcctggtgcttag

DBGET integrated database retrieval system