KEGG   Mus musculus (mouse): 209176Help
Entry
209176            CDS       T01002                                 

Gene name
Ido2, AI265623, C230043N17Rik, Ido-2, Indol1
Definition
indoleamine 2,3-dioxygenase 2 (EC:1.13.11.52)
Orthology
K00463  
indoleamine 2,3-dioxygenase [EC:1.13.11.52]
Organism
mmu  Mus musculus (mouse)
Pathway
Tryptophan metabolism
Metabolic pathways
African trypanosomiasis
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mmu00380]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:mmu05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A2; 8
AA seq 405 aa AA seqDB search
MEPQSQSMTLEVPLSLGRYHISEEYGFLLPNPLEALPDHYKPWMEIALRLPHLIENRQLR
AHVYRMPLLDCRFLKSYREQRLAHMALAAITMGFVWQEGEGQPQKVLPRSLAIPFVEVSR
NLGLPPILVHSDLVLTNWTKRNPEGPLEISNLETIISFPGGESLRGFILVTVLVEKAAVP
GLKALVQGMEAIRQHSQDTLLEALQQLRLSIQDITRALAQMHDYVDPDIFYSVIRIFLSG
WKDNPAMPVGLVYEGVATEPLKYSGGSAAQSSVLHAFDEFLGIEHCKESVGFLHRMRDYM
PPSHKAFLEDLHVAPSLRDYILASGPGDCLMAYNQCVEALGELRSYHINVVARYIISAAT
RARSRGLTNPSPHALEDRGTGGTAMLSFLKSVREKTMEALLCPGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcaaagtcagagcatgacgctggaggtgccgttgtccttggggagataccac
atttctgaggaatatggctttctccttccaaatcctctggaagcacttccagatcattac
aagccttggatggaaattgccctcagacttcctcacttaatcgagaaccgccagctccga
gctcacgtgtacaggatgcctctcctggactgcagattcctaaagagttaccgtgagcag
cgcctggcacacatggcgctggccgctatcaccatgggattcgtctggcaggagggggaa
ggccaaccccaaaaggtgctgccaagatctcttgccattccttttgttgaggtatccagg
aacttgggactcccgcctatcctggtccactctgacctggtgctgacaaactggaccaaa
aggaacccagaaggaccgttggaaatcagtaacctggaaaccatcatctcatttccgggg
ggagagagcctgcggggcttcatcctagtgacagtcttggtggagaaggcagcagtgccc
ggccttaaggccctggttcagggaatggaggccattcggcaacacagtcaggacaccctg
ctagaagccctgcagcagctgagactctccatccaggatatcaccagagccttggcccaa
atgcatgattatgtggacccagacatattttactcggtcatccggatcttcctctctggg
tggaaggacaatccagccatgcctgtggggctggtctatgaaggtgttgccacagagcct
ctgaagtactctggaggaagtgcagcccagagctccgtgcttcatgccttcgatgagttc
ctgggcattgagcattgcaaggaaagtgttggctttctacacagaatgagggactacatg
ccgccttcccataaggctttcctggaagatctccacgtagctccttctctgagagactac
atactggcctctggtcctggggactgcctgatggcctataaccagtgtgtggaggccctg
ggagagctgcgcagttaccacatcaatgtcgtggccagatacattatctccgctgccacc
agggccaggagcagggggctaactaatccctcaccccatgccttggaagacaggggcact
gggggtactgccatgctgagcttcttgaagagtgtcagggagaagaccatggaggccctc
ctgtgtcctggtgcttag

DBGET integrated database retrieval system