KEGG   Mus musculus (mouse): 20927Help
Entry
20927             CDS       T01002                                 

Gene name
Abcc8, D930031B21Rik, SUR1, Sur
Definition
(RefSeq) ATP-binding cassette, sub-family C (CFTR/MRP), member 8
  KO
K05032  
ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
mmu  Mus musculus (mouse)
Pathway
ABC transporters
Insulin secretion
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    20927 (Abcc8)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    20927 (Abcc8)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    20927 (Abcc8)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    20927 (Abcc8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B4; 7 29.66 cM
AA seq 1588 aa AA seqDB search
MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITS
VVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDHAIGFSQLRFCLTGLLVILYG
MLLLVEINVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HRKPIDLRAIGKLPIAMRALTNYQRLCAAFDAQARKDTQSQQGARAIWRALCHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFCSRVEMTRRKEMTSLRAFAVYT
SISIFMNTAIPIAAVLITFVGHVSFFKESDFSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQAVPLKVVNRKRPAREEVRDLL
GPLQRLTPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQRVSGAVFWNSSLPDSEGEDPRYCLRTSNPERETAADSDARSRGPVAYAS
QKPWLLNATVEENITFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQ
RQRISVARALYQHTNVVFLDDPFSALDVHLSDHLMQAGILELLRDDKRTVVLVTHKLQYL
PHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKAPEPSQ
GLPRAMSSRDGLLLDEDEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGVLLLS
LLVFSQLLKHMVLVAIDYWLAKWTDSALVLSPAARNCSLSQECALDQSVYAMVFTVLCSL
GIALCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQ
HIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDD
TTQLPLLSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEY
IGACVVLIAAATSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKR
IHTLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALIAPGQK
IGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSG
TIRFNLDPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLAR
AFVRKTSIFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVMVLKR
GAILEFDKPEKLLSQKDSVFASFVRADK
NT seq 4767 nt NT seq  +upstreamnt  +downstreamnt
atgcccttggccttctgcggcaccgagaaccactcggccgcctaccgggtggaccaaggt
gtcctcaacaacggctgcttcgtggacgcgctcaacgtagtgccacatgtcttcctgctc
ttcatcacattccccatcctcttcatcggatggggcagccagagctccaaggtacacatt
caccatagcacctggctccatttccctggccacaacctgcgctggatccttaccttcatg
ctgctctttgtcctggtgtgtgagatcgctgagggtatcctgtctgatggggtgacagaa
tcccgccacctccatttgtacatgccagctgggatggctttcatggctgccatcacctct
gtggtctactatcacaacattgagacctctaacttccccaagctgctgatcgctctgctt
atctactggaccttggccttcatcactaagaccatcaagttcgtcaagttctacgaccac
gccatcggcttctctcagctgcgcttctgcctcacggggcttctggtgatcctctacggg
atgctgctgctggtggagatcaatgtcatccgggtgcggaggtacatcttcttcaagacg
ccaagggaagtgaagccccctgaggacctgcaggacctgggggtgcgctttctgcagccc
ttcgtgaatctgctgtcaaaggggacctactggtggatgaatgccttcatcaagactgcc
cacaggaagcccatcgacctgcgggccatcgggaagctgcccatcgccatgagagccctc
accaactatcagcgactctgcgcggccttcgatgcccaggcgcggaaagacacgcagagc
cagcagggcgcccgggccatctggagggctctctgccatgcctttgggagacgcctggtc
ctcagcagcacattccgtatcctggctgacctgctgggctttgctggaccgctctgcatc
tttgggatcgtggaccacctcgggaaggagaaccatgtcttccagcccaagacacagttt
cttggggtttactttgtctcgtcccaagagttcctgggcaacgcctatgtcttggctgta
cttctgttcctggccctcctgctgcaaaggacgttcctgcaagcctcgtactacgtcgcc
attgaaactgggattaacctgagaggggcgatccagaccaagatttacaataagatcatg
cacttgtctacttccaacctgtcaatgggggagatgacggctgggcagatctgcaacctg
gtggccatcgacacaaatcagctcatgtggtttttcttcttatgcccaaacctctgggct
atgccagtacagatcattgtgggcgtgatcctcctctactacatccttggggtcagtgcc
ttgattggagcagctgtcatcattctgctggctcctgtacagtactttgtggccaccaag
ctctcccaggcacagcggagcaccctggaatattccaatgaaaggctgaagcagaccaac
gagatgctccggggcatcaaactgctcaaactgtacgcgtgggagaacatcttctgctcg
agggtggagatgacgcgcaggaaggaaatgaccagcctcagagccttcgctgtctacacc
tccatctccatcttcatgaacacagctatccccattgctgccgtcctcattacctttgtg
ggccacgtcagcttcttcaaagagtcagacttctcaccctcggtggcctttgcctctctc
tctctcttccacatcctggtcacaccgctgttcctgctgtctagtgtggttcggtccacc
gtcaaggccctagtgagtgtgcaaaagctgagtgagttcctgtccagtgcagagatccgt
gaggaacagtgtgccccccgagagcctgcaccccaaggccaagcgggcaagtaccaggcg
gtgcccctcaaggttgtgaaccgcaagcgcccagcccgggaagaggttcgggacctcttg
ggcccactgcagaggctgacccccagcatggatggagatgctgacaacttctgtgtccag
atcatcggaggcttcttcacctggacccctgatggaatccccaccctgtccaacatcacc
atccgtatcccccgaggccagctgaccatgattgtggggcaggtgggctgcggcaagtcc
tcgctccttctggccaccctgggggagatgcagagggtctccggggccgtcttctggaac
agcagccttccagacagcgagggagaagaccccaggtattgcctcaggacaagcaaccca
gagcgggagacagcagccgactcggatgccaggagcagaggccccgtagcctacgcatct
cagaaaccatggctgctaaatgccacggtggaggagaacatcaccttcgagagtcccttc
aataagcaaaggtacaagatggtcatcgaagcctgctccctgcagccagacatagacatc
ttaccccatggagaccagactcagattggggaacggggcatcaacttgtctggtggtcag
cgtcagcgaatcagtgtagcccgagccctctaccagcacaccaatgttgtcttcttggat
gaccctttctcagctctggatgtccatctgagcgaccacctgatgcaggctggcatcctt
gagctgctccgggatgacaagaggacagtggtcttggtgacccacaagctacagtacctg
cctcatgcagactggatcattgctatgaaggatggcaccattcagagggaggggacgctc
aaggacttccagaggtctgagtgccagctctttgagcattggaagaccctcatgaacagg
caagaccaagagctggagaaggagacagtcatggagaggaaagccccagaaccgtctcag
ggcctgccccgtgccatgtcctcaagagatggccttctgctggatgaggacgaggaggaa
gaggaggcggccgagagcgaggaagatgacaacttatcttcggtgctgcatcagcgagcc
aagatcccatggcgggcctgcactaagtatttgtcctctgccggcgtcctgctcttgtcc
ctgcttgtcttctcccagctactcaagcacatggtcttggtggccattgattactggctg
gccaagtggacggacagtgccctggtcctgagccctgctgccaggaactgctccctcagc
caggaatgcgccctggaccagtctgtctatgccatggtattcaccgtgctctgcagcctg
ggaattgcactgtgccttgtcacctctgtcactgtggagtggacaggactgaaggtggcc
aagaggctgcaccgcagcctgctcaatcgcatcatcctggcccccatgaggttctttgag
accacgcccctggggagtatcctgaacagattttcatctgactgtaacaccattgaccag
cacatcccatccacgctggagtgtctgagccgatccactctactctgtgtctccgccttg
actgtcatctcctacgtcacacctgtgttcctcgtggccctcttacccctagctgtggtg
tgctacttcatccagaaatacttccgagtggcgtccagggacctgcagcagctggatgac
acaacgcagctccctctgctctcacactttgctgaaaccgtggaaggactcaccaccatc
cgtgccttcaggtacgaggcccggttccagcagaagctcctggagtacacggactccaac
aacatcgcctccctcttcctcacggcagccaacaggtggctagaagtccgcatggagtac
attggagcatgcgtggtactcatcgcagccgccacctccatctccaactccctgcacagg
gagctctctgctggtctggtgggcctgggcctcacctacgccttgatggtctccaactac
ctcaactggatggtgaggaacctggcagacatggagatccaattgggggctgtgaagcgc
atccacacactcctgaaaactgaggcagagagctatgaggggctcctagcaccgtcattg
atccccaagaactggccagaccaagggaagattcaaattcaaaacctgagtgtgcgctat
gacagctccctgaagcccgtgctgaagcacgtcaatgccctcatcgccccaggacagaag
atcgggatctgcggccgcacaggcagtgggaagtcctccttctctctcgcctttttccga
atggtggacatgttcgaagggcgcatcatcattgatggcatcgacatcgccaagctgccg
ctgcacacgctccgttcacgcctctccatcatcctacaggaccctgtcctcttcagcggc
accatcagattcaacctggacccagagaagaaatgctcagacagcacactctgggaggct
ctggagatcgcccagctgaagctggtggtgaaggcactgccaggaggcctggatgccatc
atcacagaaggaggggagaattttagtcaaggtcagaggcagctgttctgcctggctcgg
gccttcgtgagaaagaccagcatcttcatcatggacgaagcaactgcctccattgacatg
gctacggaaaacatcctccagaaggtggtgatgacagccttcgcagaccgcactgtggtc
accatcgcgcaccgcgtacacaccatcctgagtgcagacctcgtgatggtcctgaagagg
ggagccatcctggagtttgacaaaccggagaagcttctgagccagaaggacagcgtcttc
gcctccttcgtccgcgcggacaaatga

DBGET integrated database retrieval system