KEGG   Mus musculus (mouse): 20979Help
Entry
20979             CDS       T01002                                 

Gene name
Syt1, AW124717, G630098F17Rik, SytI
Definition
(RefSeq) synaptotagmin I
  KO
K15290  
synaptotagmin-1
Organism
mmu  Mus musculus (mouse)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    20979 (Syt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 D1; 10 56.52 cM
AA seq 421 aa AA seqDB search
MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWAL
IAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKD
DDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPY
VKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDII
GEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLK
KMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVT
VLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVK
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgccagtcgtcctgaggccctggctgcccctgtcaccactgttgcgaccctt
gtcccacacaacgccactgagccagccagtcctggggaagggaaggaagatgccttttcc
aagctgaagcagaagtttatgaatgaactgcataaaatcccattgccaccgtgggcctta
attgccatagccatagttgcggtccttctagtcgtgacctgctgcttctgtgtctgtaag
aaatgtttgttcaaaaagaaaaacaagaagaagggaaaggaaaagggagggaagaacgcc
attaacatgaaagacgtgaaagacttagggaagaccatgaaggatcaggcccttaaggat
gacgatgctgaaactggactgactgatggagaagaaaaggaggagcccaaggaagaggag
aaactgggaaagcttcaatattcactggactatgacttccagaataaccagctgctggtg
ggaatcatccaggctgctgaactgcccgccctggacatgggaggcacatctgatccatac
gtcaaagtcttcctgctgcccgacaaaaagaagaagtttgagacaaaagtccaccggaaa
accctcaatccagtcttcaatgaacagtttactttcaaggtgccatactcggaattaggt
ggcaagacactggtgatggctgtgtatgattttgaccgcttctccaagcacgacatcatt
ggagagttcaaagttcctatgaacaccgtggattttggccacgtcaccgaggagtggcgc
gatctccagagtgctgagaaagaagagcaagagaaactgggtgacatctgcttctccctc
cgctacgtccctactgccggcaagctgactgttgtcattctggaagccaagaacctgaag
aagatggatgtgggtggcttatctgatccctatgtaaagattcacctgatgcagaacggc
aagagactgaagaagaaaaagacaacgattaagaagaacacacttaacccctactacaat
gagtccttcagctttgaagttccgttcgagcaaatccagaaagtgcaagtggtggtaact
gttttggactatgacaagattggcaagaacgacgccatcggcaaagtctttgtgggctac
aacagcaccggcgcagagctgcgacactggtcagacatgctggccaacccccggcgaccc
atcgcccagtggcacactctgcaggtagaggaggaggttgatgccatgctggctgtcaag
aagtaa

DBGET integrated database retrieval system