KEGG   Mus musculus (mouse): 210801Help
Entry
210801            CDS       T01002                                 

Gene name
Unc5d, D930029E11Rik, Unc5h4, mKIAA1777
Definition
(RefSeq) unc-5 netrin receptor D
  KO
K07521  
netrin receptor unc-5
Organism
mmu  Mus musculus (mouse)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04360 Axon guidance
    210801 (Unc5d)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Others
   ROBO4; roundabout, axon guidance receptor, homolog 4 (Drosophila) [KO:K06784]
    210801 (Unc5d)
 7. Others
  FLRT; leucine-rich repeat transmembrane protein FLRT [KO:K16362]
   210801 (Unc5d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8; 8 A2-A3
AA seq 956 aa AA seqDB search
MGTGAADGSRGARRWLPWLGLFFWAAGAAAARGADGSEILPDSIPSAPGTLPHFIEEPED
AYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQ
VEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRP
PEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRS
LSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCT
ALCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILD
KKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDS
SALTGGFQTFNFKTVRQGNSLLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNP
LSDIKVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNNRGFSTIHPRNKTPYIQNLSSLP
TRTELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEV
LLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSC
YCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTP
CAFQEVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQEVPFSR
VWSSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQ
EDSTFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSP
SAVILNLWEARHQQDGDLDSLACALEEIGRTHTKLSNITEPQIDDADFNYSRQNGL
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggggacaggggctgcagacggcagccgcggggcgcgccggtggctcccatggctagga
ctctttttctgggcggcgggggctgcggctgcccgaggagccgatggcagtgaaattctt
cccgactctatcccatctgcccctggaacgctgcctcatttcatcgaggagcccgaagat
gcatacatcatcaagagcaacccgattgcactcaggtgcaaagcaaggccagccatgcag
atcttcttcaaatgcaatggggagtgggtccatcagaatgaacatgtgtccgaggagagc
ctggatgagagctcaggcttgaaggtccgggaagtgtttatcaatgtcaccaggcagcaa
gtggaggacttccatgggccagaggactactggtgccagtgtgtagcgtggagccacctg
ggaacgtccaagagtaggaaggcatctgtgcgcatagcctatttacggaaaaactttgaa
caagatccacaaggcagggaggttcctattgaaggcatgatcgtgctgcattgtcgcccg
ccagagggagttccagcagcagaggtggaatggctgaaaaatgaggagcccatcgactcc
gaacaggatgagaacattgacaccagggctgaccataacttgatcatcagacaggcccgg
ctgtcagactcagggaattacacctgtatggcagccaacatcgtggccaagaggaggagc
ctctcagcaactgtggtggtctacgtgaatggaggctggtcttcctggacagagtggtca
gcctgcaatgttcgctgtggtagaggatggcagaaacgttcccggacctgcaccaacccc
gctcctctcaatggtggggccttttgtgagggaatgtcagtgcagaaaataacctgcact
gctctttgtcctgtggatggcagctgggaagtgtggagtgaatggtcagtctgcagccca
gagtgtgaacatcttcgtatccgtgagtgcacagctccacccccaagaaatgggggcaag
ttctgtgaaggtctcagccaggaatctgaaaactgcacagatggtctctgcattctagat
aaaaaacctcttcatgaaataaaaccccaaagatggagtaggagaggcattgagaatgcc
agcgacattgctttgtactccggcttgggtgcagccgtggtagctgttgcggtcctggtc
attggtgtcaccctctacagacggagccacagtgactacggagtggatgtcattgactct
tctgcattgacaggtggcttccagaccttcaacttcaaaacagttcgtcaaggaaattct
ctactactgaatcctgccatgcagccagatctgactgtgagccggacatacagcgggccc
atctgtctgcaggatccgctcgacaaggagctcatgacagagtcctcactcttcaatcct
ttatctgacatcaaagtcaaagtccagagctcatttatggtttccctgggagtgtctgag
agagcggagtaccatggcaagaatcactcggggactttcccccatggaaacaaccgcgga
ttcagtacaatacatcccagaaacaaaacgccgtacatccaaaatctgtcatcactgccg
acaaggacagagctgaggacaactggtgtctttggccatttagggggacgcttagtaatg
ccaaatacaggggtgagtctactcataccacatggtgccatcccagaggagaattcttgg
gagatttatatgtcaatcaaccaaggtgaaccgagcctgcagtcagatggatctgaggtt
ctcctgagtcctgaagtcacctgtgggcctccagatatgcttgtcacaactccctttgcg
ctgaccatccctcactgtgcagacgtcagttcagagcactggaacattcacctgaagaag
aggacccagcaggggaagtgggaggaagtgatgtcagtggaggatgagtccacatcctgt
tactgcctcttggatccctttgcctgtcacgtgctgcttgatagctttggaacgtatgcc
ctcacaggagagccaatcacagactgtgccgtaaagcagctcaaggtggctgtgtttggc
tgcatgtcctgtaactccttggattacaacctgagagtttactgtgtggacaatactcct
tgtgcatttcaggaagtgatttctgacgaacggcaccaaggcggccagctcctggaagaa
ccaaagctgctgcatttcaaagggaatacattcagtctccaggtctctgtccttgacatc
cctcccttcctctggaggatcaaaccgttcactgcatgccaggaagtccccttctcccga
gtgtggagcagcaaccggcagcccctgcactgtgccttctccctggagcgctacacgccc
accaccacccagctgtcctgcaaaatctgcattcggcagctcaaaggccatgaacagatc
ctccaagtgcagacatccatcctagagagtgaacgagaaaccatcactttcttcgcacaa
gaggacagtacctttcctgcacagactggcccaaaagccttcaaaattccctattccatc
agacagaggatctgcgccacgtttgataccccaaatgccaaaggcaaggactggcagatg
ttagcacagaagaacagcatcaataggaatttatcatatttcgctacccaaagcagccct
tccgctgtcattttgaacctctgggaagctcgtcatcagcaggatggggacctcgactcg
ctcgcctgtgcccttgaggagattgggaggacacacacgaaactatccaacatcacagag
ccacagattgatgatgctgacttcaactacagcaggcaaaatggactctag

DBGET integrated database retrieval system