KEGG   Mus musculus (mouse): 211945Help
Entry
211945            CDS       T01002                                 

Gene name
Plekhh1, AV308913, C77772, D630024D12Rik, mKIAA1200
Definition
(RefSeq) pleckstrin homology domain containing, family H (with MyTH4 domain) member 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 C3
AA seq 1356 aa AA seqDB search
MAEVKVEVASIDWQKRCLSLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAE
TQVGVMEEKIKLSNLKSVDSTGTLHQKYQELLRAVQGKDELISQLQAQLEKQKQTRAEEA
KIVQEKAAKIKEWVTVKLAELEMENQQLKTCNQQLVEQVAALQDALEDLRMTPSEELLVV
PEGTPERDPVPSGPSDQPVEQDSNPHTQILKVAVPTPSLGTLQSRDSLSEARSLEDLRFS
MVHPGETAEAKTLQSHLQKEGSPSQLCMKPGNPKHGSASYRESLVTAQGGTFPGTKTSAR
EGGPGSSLTLPKVRAPSIPRDSFQVAKRHHSQPQVGPGHCDHVVSIEIGALSALHSPGSS
KSEARAKVREEAEKMEMEALPPSGKQEERESLKSRRGELEDVELENKPPTPPLHRFPSWE
SRIYAMATSGMQLSEVSSRRSNAACYASGPSALAFPGAFSGLVYKNVTVPVYTALKGKAT
QISNVPFVDESSGSDDDCGSQASFRMSVPCSEYRKTSGLGSPRAIKRGVSMSSLSSEGDY
AIPPDACSLDSDYSEPEHKLQRTSSYSTDGEALEKSGYLLKMGSRVKTWKRRWFVLRQGQ
ILYYKSPSDVIRKPQGQVDLNSHCQIVREEEAQTFQLISGNKTYYLTAESPSLLEEWIRV
LQSLLKVQVTGPPALHQGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKRPL
GCLPVQDAHIEEVDRSCDSDEDYEAGGTGRLLSSHCTLVIHPPEHSPTYLLIGTKHEKDT
WLYHLTVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPS
EALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQIS
CRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYAIYCQRAVER
TLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQRL
NQETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKELHPGKSEGGTR
VVKLMYKNRLYFRSQVKGETERERLLLAFQASGEIVAGRFPVTKELALEMAALMAQVEYG
DLEKPTLPGPGGTPPTKAQHLLQQVLDRFYPRRYRNGAPPEQLRHLADMMATKWAALQGC
SPPECIRIYLTVARKWPLFGAKLFAAQPAQLSPKENTVVWIAVNEDGVSILDHRTMQVNI
TYPYSSVTTFGGCRDDFMLVIRSIPDQSSGKTRIDKLTFRMPAPKITETTLMMASYMNHC
SATVNLSAKLPAARQPRDLDGQFFASVSCTKGSALL
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtcaaggtggaggtggccagcatagactggcagaagcgatgcctatccctg
gaaacacagcttttccgcttccgccttcaggccagcaagataagggagctgctggctgac
aagatgcaggagctggagcagaggctgctggaggctgagcagagagctgaaaatgcagaa
actcaggtgggtgtgatggaagagaagataaaactgtccaatctgaagagtgtggactcc
acaggtaccttgcaccaaaagtaccaagaattgctgagagccgttcaaggcaaggacgag
ctcatcagccagctgcaggcacagctggagaagcagaagcagacaagagctgaagaagcc
aaaattgttcaagaaaaagctgcaaagatcaaggaatgggtgacagtaaagttagcagag
cttgaaatggaaaatcaacagctgaagacttgtaaccagcagctagtggagcaggtggcg
gcccttcaggatgctcttgaggatcttcgaatgacgccttcagaggagctgctagttgtt
cctgagggaaccccagagagggatcctgtcccttcagggcccagtgaccagcctgtggag
caggacagtaatccccatacccagattttgaaggtggctgtgcctacaccttctctgggt
accctgcagagcagggactccctgtcagaagccagaagtcttgaggatttgcgtttcagc
atggtccatcctggggaaacagcagaggccaagacccttcagtctcatcttcagaaagag
ggctctcccagtcagctgtgcatgaagcctggcaaccccaagcatgggtcagcctcttac
agagaaagtctggtcactgctcagggagggacattccctgggaccaagacctctgccagg
gaaggtggccctggtagtagcctgaccctgccaaaggtgcgggctcccagcatccctcgg
gacagcttccaagtggccaaaaggcaccacagtcagccccaggtaggccctgggcattgt
gaccacgtggtaagcattgagattggggcgctgtcagccctccactcacctggctcctcc
aagtctgaagccagagctaaagtccgggaagaagcagagaagatggagatggaggcgctg
cctccatcagggaagcaggaagagagagagagcctcaagtcccgcagaggtgaactggag
gacgtggaactggagaacaagccacctacacccccactgcacaggtttccatcttgggag
agcaggatctacgcgatggccacatcaggcatgcagctgtcagaagtgtcatcacgacga
agtaatgctgcctgctacgcttcggggccgtctgcccttgcattccctggagctttctct
ggccttgtctacaagaatgtcactgtgcctgtctacacagcactgaaggggaaagccacg
cagatcagcaatgtgccttttgtggatgagtcctccgggtctgatgatgactgcggctct
caagcaagtttccggatgtcagtcccctgctctgagtacaggaagaccagtggactaggc
agcccccgggccatcaagagaggggtctccatgtcctcactgagctctgagggtgactat
gctatccctcctgacgcctgctcactggacagtgactactcagagcctgagcacaaactc
cagcgtacttcatcgtactccaccgacggggaggcactggaaaagtcaggctacctgctg
aaaatggggagccgggtgaagacatggaagaggcgctggtttgtcctgagacagggacaa
atcctatactacaagtctccgagtgacgtcatccggaaacctcagggtcaagtggatctg
aattctcactgccagattgttcgagaggaggaagcacagacgtttcagctcatctctgga
aacaaaacctactacctaacagcagagtcccccagcctcctggaagaatggatccgtgtc
ctacagagcctgctgaaggtgcaggtcactggccctccagccctgcatcaagggggcacc
aagcctactgtgaagggctggctgaccaaggtaaagcatggccactccaagctggtctgg
tgcgccctggttgggaaaaccttctactactaccggagccacgaggacaagagacccctg
ggctgcctacctgtgcaggacgctcacatagaggaagtagatcggtcctgtgactcggac
gaagactatgaagctggaggaaccgggcgcttgctgtcctcccactgcacgctggtgatc
caccccccggagcacagccccacctacctcctcatcggcaccaagcatgaaaaggatacg
tggctttaccacctcacagtggctgcaggtggcagcaatgccaaggtgggcactgtctat
gagcagctcattgggaaactgatggatggtgagggtaacccagactccccactctggagg
caccccatgctgtgctacagccaagaagggctatgcgcctcccttaccaccttgccctcc
gaggccctgcagacggaggccctgaagctcttcaagtcctgccagctcttcatcaatgtg
ccggtggaagccgcctcagtagactaccatgtgtccctggctcagacggccctgcaggtg
tgcctcgttcaccctgagctacagagtgagatctactgccagctcatgaagcagatcagc
tgtcgcccgcctcagaagtactctcttatgcaatgctggcagctcctggctctgtgtgcc
ccactcttcctgcctcagcaccacttcctctggtatgtcaaacagcagctccaacgccat
gcagaccccagaagtgaaactggtcagtatgctatatactgccagcgagccgtggagcga
accctgcagacaggagaacgggaggccaggccatcacggatggaagtagtgtccatcttg
ctacgaaaccccttccatcactccttacccttcagcatccctgtgcactttgccaatgga
acttaccaggtggttggttttgatggctcctccacagtggatgagttcctccagcggctg
aaccaggaaacgggcatgaggaagccctcccagtctggctttgccctctttacggatgat
ccttctggcagggacctggagcactgtcttcaagggcgtgtcaagatctgtgacgccatc
tccaagtgggagcaaacgctgaaggagctgcatcctgggaagtctgagggtgggacacga
gtcgtgaagctgatgtacaagaacaggctgtactttcgaagtcaagtcaaaggggagaca
gagagagagcggctgctacttgccttccaagccagtggagaaatagtggcaggaagattt
ccagtcaccaaggaactggcccttgaaatggctgccttgatggcccaggtggagtatggg
gacttggagaagcctacgctgccaggccctgggggtacacctcccaccaaagcccagcat
ctccttcagcaggtccttgacaggttttacccaaggcgctatcgaaatggagcaccccct
gagcagctgaggcacctggcagacatgatggccaccaagtgggcagcgttacaaggctgc
tcccctcccgagtgcatccgcatctacctgactgtggctcggaaatggcctctcttcggg
gctaagctcttcgctgctcagcctgcccagctgtctcctaaggagaacactgtggtgtgg
attgctgtgaatgaggatggtgtcagcatcctggaccaccgcaccatgcaggtgaacatc
acttatccctactcttcagtgacaacgttcggtggctgcagggatgacttcatgcttgtg
attagatccattccagaccagagctctggaaaaacccgtattgacaagttgaccttccga
atgcctgctcccaagattacagaaactaccttaatgatggccagctacatgaaccactgt
tctgcaactgtgaacctatcagccaagctccctgcagcccgccagccccgagacctggat
ggacagttctttgcttctgtttcctgcactaaggggtcagctttgctgtga

DBGET integrated database retrieval system