KEGG   Mus musculus (mouse): 213043Help
Entry
213043            CDS       T01002                                 

Gene name
Aox2, Aoh3, Aox3l1
Definition
aldehyde oxidase 2 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    213043 (Aox2)
   00350 Tyrosine metabolism
    213043 (Aox2)
   00380 Tryptophan metabolism
    213043 (Aox2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    213043 (Aox2)
   00760 Nicotinate and nicotinamide metabolism
    213043 (Aox2)
   00830 Retinol metabolism
    213043 (Aox2)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    213043 (Aox2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     213043 (Aox2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 C1.3; 1 29.0 cM
AA seq 1345 aa AA seqDB search
MPCPAQISDDLEFFVNGRKVTEKNVDPEVTLLAFLRKNLCLTGTKDACGTGGCGACTVMV
SQHDPVCKKTRHFSVMACLVPLCSLHGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGF
CTPGMVMSIYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGRTFCMEPDGCPQKGT
GQCCLDQKESDSSGSKSDICTKLFVKDEFQPLDPTQELIFPPELLRMAENPEKQTLTFYG
ERITWIAPGTLQELLVLKAKYPEAPLISGNTALGPAMKSQGHFYPVLLSPARIPDLRMVT
KTSGGLTIGACCSLAQVKDILAESISELPQEKTQTYRALLKHLRSLAGQQIRNMASLGGH
VISRHCYSDLNPILSVGNTTLNLLSEEGPRQIPLSGHFLAGLASADLKPEEILGSVYIPH
SQKREFVSAFRQAQCHQNALPDVNAGMRVLFREGTDVIEELSIAYGGVGPTTVSAQRSCQ
QLLGRRWNALMLDEACRLLLDEVSLPGSALGGKVEFRRTLIVSLFFKFYLEVLQELKADQ
KLPPESTDSQRYPEIADRFLSSLGDFQVTLPRGVQTYQRVDSHQPLQDPVGRPIMHLSGL
KHATGEAVFCDDIPRVDKELFMALVTSTRAHARIISIDSSEVLDLPGVVDVITAEDIPGN
NGEEDDKLLAVDKVLCVGQVICAVVAETDVQAKRATEKIKITYEDLKPVIFTIEDAIKHN
SFLCPEKKLEQGNIEEAFENVDQVAEGTVHVGGQEHFYMETQRVLVIPKTEDKELDMYVS
TQDPAHVQKTVSSTLNIPISRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAVKTGHPIRL
VLDREDDMLITGGRHPLFAKYKVGFMNSGRIKALDIECYINGGCTLDDSELVTEFLVLKL
ENAYKIRNLRLRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
MYKTVDKTIYKQAFNPDPLIRCWNECLDKSSFHIRRTRVDEFNKKSYWKKRGIAIVPMKF
SVGFAATSYHQAAALVHIYTDGSVLVAHGGNELGQGIHTKMLQVASRELKIPLSYLHICE
TSTTTVPNTIATAASVGADVNGRAVQNACQILLKRLEPVIKKNPEGTWRDWIEAAFEKRI
SLSATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCS
LNPAIDIGQIEGAFIQGMGLYTTEELLYSPEGVLYSRSPDKYKIPTVTDVPEQFNVSLLP
SSQTPLTLYSSKGLGESGMFLGSSVFFAIVDAVAAARRQRDIAEDFTVKSPATPEWVRMA
CADRFTDMIPRDDPKTFKPWSIPIA
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccagcccagatttcggatgatctggagttctttgtgaacgggaggaaggtg
acggagaagaatgtggacccagaagtcactctgctggccttcctgagaaagaacttatgc
ctcacaggaactaaggatgcgtgtggaacaggaggctgtggggcctgcacagtgatggtg
tcacaacacgatccggtgtgcaagaagacaagacacttctccgtcatggcatgcctggtg
cccctgtgctccctgcatggggctgctgtcaccaccgtggaaggtgtgggaagcatcaag
accaggctccaccccgtgcaggagaggatcgccaagagccacggcacccagtgtggcttc
tgcacccctgggatggtgatgtccatctacacactgctcaggaaccacccgcagccctca
gaggaacagctcatggaggccttgggagggaacctctgccgctgtactgggtatcggcca
attctggagagcggcaggaccttctgcatggagccagacggttgtccacagaaaggaaca
ggacagtgttgcttggatcagaaggaaagtgactcatcgggaagcaaaagtgatatttgc
acgaagctatttgtgaaagacgagttccagcccttggacccgacccaggagctcatattt
cccccagaactcctgaggatggctgagaacccagagaagcaaaccctaaccttttatgga
gagagaatcacctggatcgccccaggaaccctccaagaactcttggtgctgaaagctaag
taccctgaagctcctctcatctcgggcaacacagccctgggaccagccatgaagtctcaa
ggacacttttaccctgtcctcctgtctcctgctagaattcctgatctaagaatggtgact
aaaaccagtggaggactgaccataggtgcctgctgcagcctggctcaggtgaaggacatc
ttggctgagagcatctctgagctcccacaggagaaaactcagacctaccgagcactcctg
aaacacctccggagcttggcgggacagcagatccggaacatggcgtccttaggaggacat
gttataagcaggcattgctactcggacctgaatcctatcctctctgtgggcaacaccaca
ctcaatctgctgtcagaagaaggcccgcggcagattcccctcagtggacattttcttgct
gggttggcaagtgcagacctgaagcccgaggagattctggggtctgtgtacatcccacac
tctcagaagcgggagttcgtgtctgccttccggcaggcccagtgccatcagaacgccttg
cctgatgtaaatgctggcatgagagtcctgttcagagaaggcacagacgtcattgaggag
ctgagcattgcctatggaggggtggggcccaccaccgtcagcgcacaaaggtcctgccag
cagcttctgggccggcgctggaacgcactgatgctagacgaggcttgcagactgcttctg
gatgaagtctcccttccaggctcagccctgggaggcaaagtggaattcaggaggactctg
attgtcagcctcttcttcaagttctacctggaggttctgcaggaactgaaggctgaccag
aagctgcccccggagtccaccgacagccagcgttatccagagatcgcagaccggttccta
agctctctgggagatttccaggtcacgctaccccggggagtccaaacataccagagagta
gattctcaccaacctctccaagatccagttggacgtcccatcatgcacctgtcaggtctt
aaacatgccacgggggaagctgtattttgtgatgacatccctagggtggataaagaactc
ttcatggctttagtcaccagtaccagagctcatgcaagaatcatatcaatcgactcatct
gaggtccttgacctgcctggtgtggttgatgtaataacagctgaagacattccaggcaac
aatggtgaagaggatgacaaattgctggctgtagataaggttctctgtgtgggccaggtc
atctgtgccgtggtggcagagactgatgttcaggcaaaacgagcaactgagaagataaaa
atcacctacgaggatctgaaacctgtgattttcaccatcgaggatgccataaagcacaat
tcgttcctgtgccctgaaaaaaagcttgaacaaggaaacatcgaggaggcctttgagaac
gtggatcaggtagctgaagggacagtccatgttggaggacaagaacacttctacatggaa
acacagagagtgcttgttattccgaagacagaagacaaagagctagacatgtatgtgtcc
acacaggacccagcccacgtacagaaaacagtgtcctctaccttaaacatcccgatcagc
aggatcacctgccatgtgaaaagagtgggtggaggctttggaggaaaggtggggaggcca
gctgtgttcggagcaattgctgcggtgggggctgtcaaaactggccatcccattcgtctt
gttctggatcgtgaagatgatatgctaataactgggggacgacacccattatttgcaaaa
tacaaagtgggattcatgaacagtggacggatcaaagccctagacattgaatgctacatc
aatggaggctgcacattggatgactcggagctggtaacagaatttcttgtactaaaactg
gaaaatgcatacaaaatccgaaacctcagactccgaggtcgtgcctgcatgacaaactta
ccatccaatacagcttttcgtgggtttggcttccctcagggagccctggtaacagaatcc
tgcatcacagctgtggcagccaaatgtgggcttccaccagaaaagattagggagaaaaac
atgtacaaaacagttgataaaaccatctacaagcaagcgttcaaccctgaccccctgata
aggtgttggaatgagtgtctggacaagtcttcctttcacatcagaaggacaagagtggac
gagttcaataagaagagttactggaagaagcgaggcattgctattgtccccatgaagttt
tcagttggctttgctgcgacaagctaccatcaggcggctgcgctcgtccatatctacacc
gatggctctgtgttggtggcacatggaggcaatgaactggggcaaggtattcacaccaaa
atgttacaggtggccagccgtgaactgaaaatacccctgtcttatctgcatatctgtgaa
acaagtacaacaacagtgcccaatacaatcgctacagccgcgtccgttggagcggatgtc
aacggcagggctgtgcagaatgcctgtcaaatccttctcaaacgtcttgagcccgtcatt
aagaaaaacccagaagggacatggagagactggatagaagcagcttttgaaaaaagaatc
agtctttcagccactggatacttcaggggctacaaggccttcatggactgggagaaagga
gagggagacccattcccgtactatgtctatggagctgcatgttctgaggttgaaatcgac
tgcctgacaggtgctcacaagaaaatcagaaccgacattgtcatggatgcatgttgcagc
ctgaatccggccattgatattgggcagatcgaaggtgcatttattcaaggaatgggcctt
tataccaccgaggagctactctactctccagagggcgtcctgtactctcggagcccggac
aagtacaaaatcccaactgtcactgatgtcccagagcagtttaacgtgtccttgctgccg
tcctctcagaccccgctcaccctctattcgtcaaagggcctcggggagtctgggatgttc
ctagggtcatctgtgttttttgccattgttgatgcggtggctgcggcacggagacaaaga
gacatagcggaggacttcacagtgaagagcccagcaaccccagagtgggtgcggatggcc
tgtgcagatcggttcacggacatgatcccgagagatgacccaaaaacgtttaaaccttgg
tctatacctatagcttaa

DBGET integrated database retrieval system