KEGG   Mus musculus (mouse): 213043Help
Entry
213043            CDS       T01002                                 

Gene name
Aox2, Aoh3, Aox3l1
Definition
aldehyde oxidase 2
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mmu00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mmu00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mmu00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mmu00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mmu00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mmu00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mmu00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 C1.3; 1 29.0 cM
AA seq 1345 aa AA seqDB search
MPCPAQISDDLEFFVNGRKVTEKNVDPEVTLLAFLRKNLCLTGTKDACGTGGCGACTVMV
SQHDPVCKKTRHFSVMACLVPLCSLHGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGF
CTPGMVMSIYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGRTFCMEPDGCPQKGT
GQCCLDQKESDSSGSKSDICTKLFVKDEFQPLDPTQELIFPPELLRMAENPEKQTLTFYG
ERITWIAPGTLQELLVLKAKYPEAPLISGNTALGPAMKSQGHFYPVLLSPARIPDLRMVT
KTSGGLTIGACCSLAQVKDILAESISELPQEKTQTYRALLKHLRSLAGQQIRNMASLGGH
VISRHCYSDLNPILSVGNTTLNLLSEEGPRQIPLSGHFLAGLASADLKPEEILGSVYIPH
SQKREFVSAFRQAQCHQNALPDVNAGMRVLFREGTDVIEELSIAYGGVGPTTVSAQRSCQ
QLLGRRWNALMLDEACRLLLDEVSLPGSALGGKVEFRRTLIVSLFFKFYLEVLQELKADQ
KLPPESTDSQRYPEIADRFLSSLGDFQVTLPRGVQTYQRVDSHQPLQDPVGRPIMHLSGL
KHATGEAVFCDDIPRVDKELFMALVTSTRAHARIISIDSSEVLDLPGVVDVITAEDIPGN
NGEEDDKLLAVDKVLCVGQVICAVVAETDVQAKRATEKIKITYEDLKPVIFTIEDAIKHN
SFLCPEKKLEQGNIEEAFENVDQVAEGTVHVGGQEHFYMETQRVLVIPKTEDKELDMYVS
TQDPAHVQKTVSSTLNIPISRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAVKTGHPIRL
VLDREDDMLITGGRHPLFAKYKVGFMNSGRIKALDIECYINGGCTLDDSELVTEFLVLKL
ENAYKIRNLRLRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
MYKTVDKTIYKQAFNPDPLIRCWNECLDKSSFHIRRTRVDEFNKKSYWKKRGIAIVPMKF
SVGFAATSYHQAAALVHIYTDGSVLVAHGGNELGQGIHTKMLQVASRELKIPLSYLHICE
TSTTTVPNTIATAASVGADVNGRAVQNACQILLKRLEPVIKKNPEGTWRDWIEAAFEKRI
SLSATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCS
LNPAIDIGQIEGAFIQGMGLYTTEELLYSPEGVLYSRSPDKYKIPTVTDVPEQFNVSLLP
SSQTPLTLYSSKGLGESGMFLGSSVFFAIVDAVAAARRQRDIAEDFTVKSPATPEWVRMA
CADRFTDMIPRDDPKTFKPWSIPIA
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccagcccagatttcggatgatctggagttctttgtgaacgggaggaaggtg
acggagaagaatgtggacccagaagtcactctgctggccttcctgagaaagaacttatgc
ctcacaggaactaaggatgcgtgtggaacaggaggctgtggggcctgcacagtgatggtg
tcacaacacgatccggtgtgcaagaagacaagacacttctccgtcatggcatgcctggtg
cccctgtgctccctgcatggggctgctgtcaccaccgtggaaggtgtgggaagcatcaag
accaggctccaccccgtgcaggagaggatcgccaagagccacggcacccagtgtggcttc
tgcacccctgggatggtgatgtccatctacacactgctcaggaaccacccgcagccctca
gaggaacagctcatggaggccttgggagggaacctctgccgctgtactgggtatcggcca
attctggagagcggcaggaccttctgcatggagccagacggttgtccacagaaaggaaca
ggacagtgttgcttggatcagaaggaaagtgactcatcgggaagcaaaagtgatatttgc
acgaagctatttgtgaaagacgagttccagcccttggacccgacccaggagctcatattt
cccccagaactcctgaggatggctgagaacccagagaagcaaaccctaaccttttatgga
gagagaatcacctggatcgccccaggaaccctccaagaactcttggtgctgaaagctaag
taccctgaagctcctctcatctcgggcaacacagccctgggaccagccatgaagtctcaa
ggacacttttaccctgtcctcctgtctcctgctagaattcctgatctaagaatggtgact
aaaaccagtggaggactgaccataggtgcctgctgcagcctggctcaggtgaaggacatc
ttggctgagagcatctctgagctcccacaggagaaaactcagacctaccgagcactcctg
aaacacctccggagcttggcgggacagcagatccggaacatggcgtccttaggaggacat
gttataagcaggcattgctactcggacctgaatcctatcctctctgtgggcaacaccaca
ctcaatctgctgtcagaagaaggcccgcggcagattcccctcagtggacattttcttgct
gggttggcaagtgcagacctgaagcccgaggagattctggggtctgtgtacatcccacac
tctcagaagcgggagttcgtgtctgccttccggcaggcccagtgccatcagaacgccttg
cctgatgtaaatgctggcatgagagtcctgttcagagaaggcacagacgtcattgaggag
ctgagcattgcctatggaggggtggggcccaccaccgtcagcgcacaaaggtcctgccag
cagcttctgggccggcgctggaacgcactgatgctagacgaggcttgcagactgcttctg
gatgaagtctcccttccaggctcagccctgggaggcaaagtggaattcaggaggactctg
attgtcagcctcttcttcaagttctacctggaggttctgcaggaactgaaggctgaccag
aagctgcccccggagtccaccgacagccagcgttatccagagatcgcagaccggttccta
agctctctgggagatttccaggtcacgctaccccggggagtccaaacataccagagagta
gattctcaccaacctctccaagatccagttggacgtcccatcatgcacctgtcaggtctt
aaacatgccacgggggaagctgtattttgtgatgacatccctagggtggataaagaactc
ttcatggctttagtcaccagtaccagagctcatgcaagaatcatatcaatcgactcatct
gaggtccttgacctgcctggtgtggttgatgtaataacagctgaagacattccaggcaac
aatggtgaagaggatgacaaattgctggctgtagataaggttctctgtgtgggccaggtc
atctgtgccgtggtggcagagactgatgttcaggcaaaacgagcaactgagaagataaaa
atcacctacgaggatctgaaacctgtgattttcaccatcgaggatgccataaagcacaat
tcgttcctgtgccctgaaaaaaagcttgaacaaggaaacatcgaggaggcctttgagaac
gtggatcaggtagctgaagggacagtccatgttggaggacaagaacacttctacatggaa
acacagagagtgcttgttattccgaagacagaagacaaagagctagacatgtatgtgtcc
acacaggacccagcccacgtacagaaaacagtgtcctctaccttaaacatcccgatcagc
aggatcacctgccatgtgaaaagagtgggtggaggctttggaggaaaggtggggaggcca
gctgtgttcggagcaattgctgcggtgggggctgtcaaaactggccatcccattcgtctt
gttctggatcgtgaagatgatatgctaataactgggggacgacacccattatttgcaaaa
tacaaagtgggattcatgaacagtggacggatcaaagccctagacattgaatgctacatc
aatggaggctgcacattggatgactcggagctggtaacagaatttcttgtactaaaactg
gaaaatgcatacaaaatccgaaacctcagactccgaggtcgtgcctgcatgacaaactta
ccatccaatacagcttttcgtgggtttggcttccctcagggagccctggtaacagaatcc
tgcatcacagctgtggcagccaaatgtgggcttccaccagaaaagattagggagaaaaac
atgtacaaaacagttgataaaaccatctacaagcaagcgttcaaccctgaccccctgata
aggtgttggaatgagtgtctggacaagtcttcctttcacatcagaaggacaagagtggac
gagttcaataagaagagttactggaagaagcgaggcattgctattgtccccatgaagttt
tcagttggctttgctgcgacaagctaccatcaggcggctgcgctcgtccatatctacacc
gatggctctgtgttggtggcacatggaggcaatgaactggggcaaggtattcacaccaaa
atgttacaggtggccagccgtgaactgaaaatacccctgtcttatctgcatatctgtgaa
acaagtacaacaacagtgcccaatacaatcgctacagccgcgtccgttggagcggatgtc
aacggcagggctgtgcagaatgcctgtcaaatccttctcaaacgtcttgagcccgtcatt
aagaaaaacccagaagggacatggagagactggatagaagcagcttttgaaaaaagaatc
agtctttcagccactggatacttcaggggctacaaggccttcatggactgggagaaagga
gagggagacccattcccgtactatgtctatggagctgcatgttctgaggttgaaatcgac
tgcctgacaggtgctcacaagaaaatcagaaccgacattgtcatggatgcatgttgcagc
ctgaatccggccattgatattgggcagatcgaaggtgcatttattcaaggaatgggcctt
tataccaccgaggagctactctactctccagagggcgtcctgtactctcggagcccggac
aagtacaaaatcccaactgtcactgatgtcccagagcagtttaacgtgtccttgctgccg
tcctctcagaccccgctcaccctctattcgtcaaagggcctcggggagtctgggatgttc
ctagggtcatctgtgttttttgccattgttgatgcggtggctgcggcacggagacaaaga
gacatagcggaggacttcacagtgaagagcccagcaaccccagagtgggtgcggatggcc
tgtgcagatcggttcacggacatgatcccgagagatgacccaaaaacgtttaaaccttgg
tctatacctatagcttaa

DBGET integrated database retrieval system