KEGG   Mus musculus (mouse): 213326Help
Entry
213326            CDS       T01002                                 

Gene name
Scyl2, AU015688, AW536445, BC030932, CVAK104, D10Ertd802e
Definition
(RefSeq) SCY1-like 2 (S. cerevisiae)
  KO
K17541  
SCY1-like protein 2
Organism
mmu  Mus musculus (mouse)
Brite
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  SCY1 family [OT]
   213326 (Scyl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C2; 10 45.05 cM
AA seq 930 aa AA seqDB search
MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQE
VAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTE
PVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVT
PENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILS
VSCETASDMYSLGAVMYAVFNQGRPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTSIPEEV
REHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVL
PKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYIKLILPELGPVFKQQ
EPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLID
YPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEP
AVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLS
RLESEHRTKLEQLHVMQEQQRSLDIGNQMSTSEETKVAHSGSQQIDKVFNNIGADLLSGS
ESENREDGMQGKQKRGSLTLEEKQKLAKEQEQAQKLKSQQPLKPQVHTPIAPIKQTKDLT
DTLMENMSSLTSLSVSTPKISASSTFTPVPSTGLGMMFSTPIDNTKRNLTNGLNANMGFQ
TSGFSMPVNPNQNFFSGTGTAGVTTMSLGAPPTMSNFSPLTIPPASVKQPQQRPTDMSAL
NNLFGPQKPKVSMNQLSQQKPNQWLNQFAPPQGSPVMGSAAMGTQGNVMGQAAFGMQGNP
FFNPQNFAQPPPTTMTSSSSASNDLKDLFG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgcttaataaactgaagagtactgttacaaaagtaacagctgatgtcacc
agtgctgtgatgggaaatcccgtcactagagagtttgatgttggtcgacacattgccagt
ggtggcaatgggttggcatggaagatttttaatggcacaaagaagtcaacaaaacaggaa
gtggctgtttttgtctttgataaaaagctgattgacaaatatcaaaaatttgaaaaggat
caaatcattgattctttaaaacgcggagtccaacagctaacccgactacgacaccctcga
cttcttactgtccagcatcctttagaagagtcaagggattgcttggcattttgtacagaa
ccagtttttgccagtttagccaatgttcttggtaactgggaaaatctaccctcttcaata
tctccagacatcaaggattataaactttatgatgtagaaactaagtatggtttgcttcag
gtttctgaaggattgtcatttttgcatagcagtgtaaaaatggttcatggaaatgttact
cctgaaaatgtcattttgaataaaagcggagcctggaaaataatggggtttgacttctgt
gtgtcatcaagcaacccttctgaacaggagcctaagtttccttgtaaagagtgggaccca
aacttgccatcattgtgtcttccgaatcctgaatacttggctcctgaatatatcctgtcc
gtgagctgtgagactgccagtgacatgtactcgttaggagctgttatgtacgccgtgttt
aatcaagggagacctatatttgaagtcaacaagcaggacatttacaagagcttcagtaga
caactggatcagttgagtcgtttaggatctagttcactgaccagtatacccgaggaagtt
cgtgaacacgtaaaactgttgttaaatgtaactccaaccgtgagacccgatgcagatcaa
atgacaaaaattcccttctttgatgatgttggtgcagtaacacttcaatattttgatacc
ttattccaaagagataatcttcagaaatcacagttcttcaaaggattgccaaaggttcta
ccaaagctgcccaagcgtgtcattgtgcagaggattttaccctgtctgacctcagaattt
gtcaaccctgatatggtacctttcgttttacctaatgttctgctcattgctgaggaatgc
accaaagaagaatatatcaaattaattctgcctgaactcggtcctgtattcaaacagcag
gagccaatccagattttgctaatttttctacaaaaaatggatttgctgctaaccaaaacc
cctcctgatgagataaagaacagtgtcctgcccatggtctacagagctctggaggctcct
tccattcagatccaggagctctgtctaaacatcattccaacatttgcaaatcttatagac
tacccgtccatgaaaaacgctttgattccaagaattaaaaatgcctgtttacaaacgtct
tcccttgctgtccgtgtgaattcattagtgtgcttagggaagatcctggagtacctggat
aagtggtttgtgcttgatgatatcctacccttcttacagcagattccctccaaggagcct
gcagtcctcatggggattttaggtatttataaatgtacttttactcataaaaaattggga
atcaccaaagagcagctggctgggaaagtcctgcctcatctcatccccctgagcattgaa
aacaacctcaacctcaatcagttcagctccttcattgccgtcataaaggagatgctgagc
agactggagtctgagcataggacgaagctagagcagcttcacgtgatgcaggagcagcag
aggtctttggacatagggaatcaaatgagcacttctgaggagacaaaagttgcacattct
ggaagtcagcagattgataaggtctttaacaacattggagcggaccttctaagtggcagt
gaatcagaaaatagagaagatgggatgcagggaaaacagaaaagggggtcactaacactt
gaagaaaaacagaaattagcgaaagaacaggagcaggcacagaagctgaaaagccagcag
cctcttaagccccaggtccacactcccatcgctcccattaaacagactaaggacttgaca
gacacactgatggaaaacatgtcgtctctgaccagcctttctgttagcactcctaagatt
tctgcttcaagtaccttcaccccagttccttccacgggcctcggcatgatgttttcaaca
cccattgataatacaaagagaaatttgacaaatggcctgaatgccaacatgggctttcag
acttcagggttcagcatgccagtcaatccaaaccagaacttcttcagtgggacgggcaca
gctggcgtgaccaccatgagtctgggagcacctcccactatgtcaaactttagccctttg
actattcctcctgctagcgtgaagcagcctcaacagagaccaaccgatatgtctgccctc
aataatctctttggccctcagaaacccaaagttagcatgaaccagctatcccaacagaaa
ccaaatcagtggctgaatcagtttgcacctcctcaaggctctcctgtcatgggcagcgca
gccatgggcacacaggggaatgtgatggggcaggctgcctttggtatgcagggcaaccct
ttcttcaacccacagaactttgcacagccaccacccaccactatgaccagcagcagttca
gctagcaacgatttgaaagatctttttgggtga

DBGET integrated database retrieval system