KEGG   Mus musculus (mouse): 21335Help
Entry
21335             CDS       T01002                                 

Gene name
Tacc3, Aint, C86661, Eric1
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mmu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B2; 5
AA seq 630 aa AA seqDB search
MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVPPQSQAKATNVTFQTP
PRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVDDAPVVQMAAEILRAEG
ELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVLESELVTPPVEPVLEPSH
QELEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEPVLESELV
TPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPLLEPSH
QGLEPVVDLKEESFRDPSEVLGTGAEVDYLEQFGTSSFKESAWRKQSLYVKFDPLLKDSP
LRPMPVAPITNSTQDTEEESGSGKPTEAELVNLDFLGDLDVPVSAPPLCVLEPRGLLPAE
PIVDVLKYSQKDLDAVVNVMQQENLELKSKYEDLNTKYLEMGKSVDEFEKIAYKSLEEAE
KQRELKEIAEDKIQKVLKERDQLNADLNSMEKSFSDLFKRFEKRKEVIEGYQKNEESLKK
YVGECIVKIEKEGQRYQALKIHAEEKLRLANEEIAQVHSKAQAEVLALQASLRKAQMQNH
SLEMTLEQKTKEIDELTRICDDLISKMEKI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcatgtcttaaatgacgaaaacgtgcccaatgaaaagagttcacagtgccgt
gatttccagtttttgccaccagaacttaccggcagatcatctgttctttgtctgtcacag
aaagaaaatgtaccaccccagagccaggctaaggccacaaatgtgacgttccagacacca
cctcgggatccacagacacacaggatcttaagtcctaacatgaccaataagcgtgaggct
ccttttggattacaaaatgaccactgtgtcttcttacagaaagaaaaccagcggccttta
gccccagtggatgatgcacctgtggttcaaatggcagctgagatcctaagagcagaaggc
gagttacaggagggaatcttgacttcctcaagcctttcagcttccacaagtcttctggac
agtgagctggtgacccctcctatcgagccagtgctggagccttcccatcagggactagaa
cctgtcttggaaagtgagctggtgacccctcctgttgagccagtgctggagccttcccat
caggaactagaacctgtcttggaaagtgagctggtgacccctcctattgagccagtgctg
gagccttcccatcagggactagaacctgtcttggacagtgagctggtgacccctcctatt
gagccagtgctggagccttcccatcagggactagaacctgtcttagaaagtgagctggtg
acccctcctattgagccagtgctggagccttcccatcagggactagaacctgtcttggac
agtgagctggtgacccctcctattgagccagtgctggagccttcccatcagggactagaa
cctgtcttggacagtgagctggtgacccctcctatcgagcctttgctggagccttcccat
cagggactagaacctgtcgtggatctaaaggaagagagcttcagagacccatcagaagtc
ctaggtactggtgctgaagtggattatctggagcagtttggaacttcctcgtttaaggag
tcggcctggaggaagcagtctttgtacgtgaaatttgaccctcttctgaaagacagccct
ttgcggccaatgccggtggccccaataacaaatagtacacaggatacagaggaggagtct
ggttctggaaagccgacagaagctgagcttgtcaacttagatttcttgggagatttggat
gttccggtatctgccccacccctgtgtgtccttgagcctcgaggtctccttcctgctgag
cctattgtggatgtgctgaagtacagccagaaagacctggatgcagtggtgaatgtgatg
cagcaggagaacttggagctgaaaagcaagtatgaggacctcaacacaaaatatttggag
atggggaagtccgttgatgagtttgagaagatcgcgtacaaatcattggaggaggctgag
aaacagagggaactaaaggaaatagctgaagacaaaatccaaaaggttttaaaagagaga
gaccaacttaatgcagacctgaactccatggaaaagtccttttctgaccttttcaaacgg
tttgagaagcggaaggaagtgattgaaggctaccagaagaatgaagagtcactgaagaag
tatgttggggaatgcatagtgaaaattgaaaaagaaggccagaggtaccaggcgctgaag
atccatgcagaagaaaagctcaggctggcaaatgaggagatcgcccaggtacacagcaag
gcccaagcagaggtactggctttgcaggcaagcctgaggaaggcacaaatgcagaaccac
tcgctggagatgactctggagcagaagacaaaagaaattgatgagctgacccggatctgt
gatgacctcatctctaagatggagaagatctga

DBGET integrated database retrieval system