KEGG   Mus musculus (mouse): 213435Help
Entry
213435            CDS       T01002                                 

Gene name
Mylk3, D830007F02Rik, MLCK
Definition
(RefSeq) myosin light chain kinase 3 (EC:2.7.11.18)
  KO
K00907  
myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Platelet activation
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    213435 (Mylk3)
   04022 cGMP - PKG signaling pathway
    213435 (Mylk3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    213435 (Mylk3)
  Cellular commiunity
   04510 Focal adhesion
    213435 (Mylk3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    213435 (Mylk3)
  Endocrine system
   04921 Oxytocin signaling pathway
    213435 (Mylk3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    213435 (Mylk3)
  Digestive system
   04971 Gastric acid secretion
    213435 (Mylk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     213435 (Mylk3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  MLCK family
   213435 (Mylk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 C3
AA seq 795 aa AA seqDB search
MSGVSEEDPEGLAPQGLPALGGACLATMDKKLNVLTEKVDRLLHFQEDVTEKLQCVCQGM
DHLEQDLHRLEASRELSLAGSGSTPPTTAQAAWPEVLELVRAVRQEGAQHGARLEALFKM
VVAVDRAITLVGSTFQNSKVADFIMQGTVPGRKGSLADGPEENKEQAEVAGVKPNHVLTT
GGVQADASRTLWEESQKEDIPVRTVEGLPLIINTSLKGADLTQAGASLRQGVEVLGPGQV
PLPTEAESRLPETASENTGATLELSVAIDRISEVLTSLKMSQGGGQETSSSKPDCWLSEE
AMRLSSGPLPQPLGPLTPDSDIHSGDALPRIPINMQEMATPGELLETQSGSPIGSAEAPG
LGTVLEDQIPKGARPFPPLPKRSSNNGGMSAEEEIGSGAEPMRGPSLATRDWRDETVGTT
DLQQGIDPGAVSPEPGKDHAAQGPGRTEAGRLSSAAEAAIVVLDDSAAPPAPFEHRVVSI
KDTLISAGYTVSQHEVLGGGRFGQVHRCTERSTGLALAAKIIKVKNVKDREDVKNEVNIM
NQLSHVNLIQLYDAFESKSSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGV
HYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVV
NYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAK
DFVSRLLVKEKSCRMSATQCLKHEWLSHLPAKASGSNVRLRSQQLLQKYMAQSKWKKHFH
VVTAVNRLRKFPTCP
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagtttcagaggaggacccagagggtctggccccccagggtctgccagcattg
ggcggagcctgcttagccaccatggacaaaaaacttaatgtgctgactgagaaggtcgac
agactcttgcatttccaagaagatgtcacagagaagctgcagtgtgtgtgccaaggcatg
gatcacctggaacaagatctgcatcggctggaggcctcccgggagttgagtctggcaggg
tctggcagcactcccccaaccacggctcaggccgcatggcctgaggtcctggagctggtg
agggctgtgcggcaggagggtgcccagcatggtgccaggctcgaagccctcttcaagatg
gtggtggctgtggacagggctattactttggtagggtccacattccagaattccaaggtg
gctgatttcatcatgcaaggaaccgtgcccgggagaaaaggcagtctggccgatggcccg
gaggagaacaaggagcaagcagaagttgctggagtgaagccaaaccatgtactgactaca
ggaggtgtgcaagctgacgcctctaggacgctgtgggaagagagccaaaaggaggacata
cctgtgcgaacagtggaggggctgcctctcatcatcaatacgtcactgaagggagctgac
ctaacccaggcaggagcctcactgaggcagggagttgaagttcttggcccaggccaagta
cccctacccacagaagcagaatccaggcttcctgagacagccagtgagaacactggagcc
accctggaattgtccgtagcaatcgacagaatcagcgaggtcctcactagcctcaagatg
tcacaaggtggtggtcaagaaacctcatccagcaagcctgactgttggctttcagaagag
gccatgaggctgagttcagggcctctccctcagcccctaggaccactaactccagacagt
gacattcacagtggtgatgcacttcccaggatccctatcaatatgcaagagatggctact
cctggggagttgcttgagacccaaagtggcagtcccattggctctgcagaagctccaggc
cttgggactgtgttagaagaccagatccctaaaggagccagaccatttccacccctgcca
aagaggagcagcaacaatggtggcatgagtgcagaggaggagatagggtctggggctgag
cctatgagaggaccaagcttggctacaagggactggagagatgagactgttgggaccaca
gacctgcagcaaggcatagacccaggagcagtgagccctgagcctgggaaggaccacgca
gcccagggcccaggaagaactgaagctggaaggctatcttctgctgcagaggctgccatt
gtggttctagatgacagcgcagcacccccagccccttttgaacaccgggtagtgagcatc
aaagataccctgatctcagcaggctacacggtatcccaacatgaagtcttaggagggggt
cggtttggccaggtgcacaggtgtacagagaggtctacaggccttgcactggcagccaag
atcatcaaagtgaagaacgtaaaggaccgggaggatgtgaagaatgaggtcaacatcatg
aaccagctcagccacgtaaacttgatccaactttatgatgcgtttgagagcaagagcagc
ttcactctgatcatggagtatgtggatggaggcgaactctttgaccggatcacggatgag
aagtaccacctcactgagttggatgtggtcttgttcacgaggcagatctgtgagggtgtg
cattacctgcatcagcactatatcctgcacctggacctcaagcctgagaacatattgtgt
gtcagccagacagggcatcaaattaagatcattgactttgggctggctagaagatacaag
cctcgggagaagctaaaggtgaactttggtactccggagttcctggccccagaagttgtt
aactatgagtttgtgtcatttccaacagacatgtggagtgtgggagttatcacctacatg
ctactcagtggtttgtccccatttctaggggagacagatgcagagaccatgaattttatt
gtgaactgcagctgggatttcgatgctgataccttcaaagggctgtcggaggaagccaag
gactttgtttcccggttactggtcaaagagaagagctgtaggatgagcgccacacagtgc
ctgaaacacgagtggttaagtcacctgcctgccaaagcctcgggctccaacgttcgcctc
agatcccaacaactgctgcagaaatatatggctcagagtaaatggaagaaacatttccac
gtggtgactgcagtcaacaggctacggaaatttccaacgtgtccctaa

DBGET integrated database retrieval system