KEGG   Mus musculus (mouse): 213539Help
Entry
213539            CDS       T01002                                 

Gene name
Bag2, 2610042A13Rik, BC016230
Definition
(RefSeq) BCL2-associated athanogene 2
  KO
K09556  
BCL2-associated athanogene 2
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    213539 (Bag2)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  BAG
   213539 (Bag2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1; 1 B
AA seq 210 aa AA seqDB search
MAQAKISAKAHEGRFCRSSSMADRSSRLLESLDQLELRVEALRDAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQEESLKHATRIIDEV
VSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IDNSDKAIKLLEHAKGAGSKSLQNTDGKFN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcgaagatcagcgccaaggcccacgagggccgcttctgccgctcgtcttcc
atggccgaccgctccagccgcctgctggagagtctggaccagctggagctcagggtggaa
gctttgagagacgcagctactgctgttgagcaggagaaagaaatccttctggagatgatc
cacagtatccaaaacagccaggacatgaggcagattagcgatggagaaagagaggaacta
aacctgactgccaaccgtctgatgggccggaccctcacggttgaggtctcggtggaaacg
atccgaaacccccagcaggaggaatccttgaagcatgccacgaggattatagacgaggtg
gtcagcaagttcctagatgacctggggaatgccaagagccacttaatgtcactttacagt
gcctgctcatcggaggtgccgcctgggccggtggaccagaagtttcaatcgatagtcatc
ggttgcgctcttgaggatcagaagaaaatcaagaggcgattggagactctgctgaggaac
attgacaactccgacaaggccattaaactcctagagcatgctaaaggagctggttccaaa
agcctgcagaacactgacggcaaatttaattag

DBGET integrated database retrieval system