KEGG   Mus musculus (mouse): 21356Help
Entry
21356             CDS       T01002                                 

Gene name
Tapbp, D17Wsu91e, TPN
Definition
(RefSeq) TAP binding protein
  KO
K08058  
TAP binding protein (tapasin)
Organism
mmu  Mus musculus (mouse)
Pathway
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    21356 (Tapbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 17.98 cM
AA seq 465 aa AA seqDB search
MKPLLLLVAVALGLATVVSVVSAGPEAIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPR
PDLDPKLYFKVDDPAGMLLAAFRRYPAGASAPHCEMSRFIPFPASAKWARSLSPEQNCPR
ALDGDWLLVSVSSTLFSLSSLLRPQPEPLREPVVITMATVVLTVLTHNPAPRVQLGKDAV
LDLRFAYAPSALEGSPSLDAGPPPFGLEWRRQHRGKGHLLLAATPGLAGRMPPAQEKATA
FAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYLATVHLPYLQGQVSLELTVHKAPRVSLT
PAPVVWAAPGEAPPELLCLASHFFPAEGLEVKWELRGGPGGSSRKVEGKTWLSTIRHHSD
GSVSQSGHLQLPPVTAKQHGVHYVCRVYHSSLPASGRSADVTLEVAGFSGPSIEDGIGLF
LSAFLLLGLLKVLGWLAAYWTIPEVSKEKATAASLTIPRNSKKSQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctctgctcctgctcgtcgctgtggcactgggcctagcgaccgtcgtctccgtc
gtctcggctggaccagaggcgatcgagtgctggttcgtggaggatgcaggtgggggtggc
ctgtctaagaaacctgccacactgctactgcgccatggacccaggggaccgccgccccgg
ccagatcttgacccaaagctatacttcaaggtggatgacccggcgggaatgctcctggcc
gccttcaggcggtaccccgcaggcgcctccgccccacactgcgagatgagccgcttcatc
ccgttccctgcctcggcgaagtgggctagaagtctgagtccggagcagaactgcccgcgg
gccctggacggggattggctgctggtcagcgtatccagcactctcttcagcctctccagc
ctgctgcgaccacagccggagcctctgcgggagcctgtcgtcatcaccatggcaacagtg
gtgctgaccgtcctcacccataaccctgcccctcgagtccagctgggaaaggatgcagtg
ctggacctgcgcttcgcctacgcaccctccgccctggaaggttctccctctctggacgca
ggccctcctccctttgggctggagtggcgacgccagcacaggggaaagggtcacctgctg
ttggctgccacccccgggctggccgggagaatgccaccagcccaggaaaaggctacggca
tttgcagcttgggatgacgatgagccctggggcccgtggactgggaatgggaccttctgg
cttccagccgtgaagccttctcaggagggtgtctacctggctacggtacacctgccctac
ctgcaaggacaggtctccctggagctgactgtgcacaaggcccccagagtgtctctaaca
ccagcacccgttgtgtgggctgccccaggagaggcacccccagaactgctctgtcttgca
tcccacttcttccctgcggagggtctggaggtcaagtgggagctcagaggcggcccagga
ggaagttctagaaaggttgaggggaagacgtggctctccaccatccgccaccattccgat
ggctctgtcagccagtctgggcacctgcagctacctccagtcactgccaagcagcatgga
gttcactatgtctgtcgggtgtaccactctagcctgccagcatcggggcgcagtgctgac
gtcaccctggaggtggcaggcttctcagggccctccatcgaggacggcatcggcctgttc
ctgtctgcttttctcctcctcggactcctcaaggtgctaggctggctggctgcctactgg
accattcctgaagtctcaaaggagaaggccacagctgccagcctgaccattcccaggaac
tcaaagaagtcacagtaa

DBGET integrated database retrieval system