KEGG   Mus musculus (mouse): 21390Help
Entry
21390             CDS       T01002                                 

Gene name
Tbxa2r, TP, TXA2-R
Definition
(RefSeq) thromboxane A2 receptor
  KO
K04264  
thromboxane A2 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    21390 (Tbxa2r)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    21390 (Tbxa2r)
 Organismal Systems
  Immune system
   04611 Platelet activation
    21390 (Tbxa2r)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Lipid
   Thromboxane
    21390 (Tbxa2r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 C1; 10 39.72 cM
AA seq 341 aa AA seqDB search
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS
SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL
LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW
CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM
MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL
DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccaatggcacctcgctgggggcctgctttcgcccggtgaacatcacgctgcag
gagcgacgtgccatcgcgtcgccatggttcgctgcgtccttttgcgcgctgggcctgggg
tccaacctgctggcactgagtgtgctggctggggcgcggcccggcgcgggaccccgctcc
tccttcctcgctctgctgtgcggccttgttctcaccgacttcctggggctgctagtcacc
ggcgccatcgtggcgtcgcaacacgctgccttgttggactggcgagccactgaccccagc
tgccgcctgtgctacttcatgggggtagctatggtgttcttcgggctgtgtcccctgctc
ctgggggccgccatggcctctgagcgcttcgtgggcatcacacggcccttctcacgaccc
acggccacatcgcgccgcgcctgggctactgtcgggctggtgtgggtggcggccggggca
ctcgggctgctgccactactggggcttggccgctacagtgtgcagtaccccggctcttgg
tgcttcctgacactcgggacacagcgcggtgacgtggtcttcgggctcatattcgcactc
ctgggcagcgcgtccgtggggctgtccctcctgctcaacaccgttagtgtggccacactc
tgccgggtctaccacacgcgcgaggccacacagcgcccacgggactgcgaggtggagatg
atggttcagctcgtgggcatcatggtggtggccacggtgtgttggatgcccttgctggtc
ttcatcatgcagactttgttgcagacaccacctgtcatgagcttctctgggcagctgttg
cgggccacagagcaccagctgctcatctacctgcgtgtggccacctggaaccagatcttg
gacccctgggtctatatcctctttcgccggtctgtgctccggcgcctgcatccgcggttc
agttcacagctccaggctgtgtccttgcgccggcctccagcccaggccatgctcagtgga
ccctga

DBGET integrated database retrieval system