KEGG   Mus musculus (mouse): 214084Help
Entry
214084            CDS       T01002                                 

Gene name
Slc18a2, 1110037L13Rik, 9330105E13, Vmat2
Definition
(RefSeq) solute carrier family 18 (vesicular monoamine), member 2
  KO
K08155  
MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
Synaptic vesicle cycle
Serotonergic synapse
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    214084 (Slc18a2)
   04726 Serotonergic synapse
    214084 (Slc18a2)
   04721 Synaptic vesicle cycle
    214084 (Slc18a2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    214084 (Slc18a2)
  Substance dependence
   05030 Cocaine addiction
    214084 (Slc18a2)
   05031 Amphetamine addiction
    214084 (Slc18a2)
   05034 Alcoholism
    214084 (Slc18a2)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC18: Vesicular amine transporter
   214084 (Slc18a2)
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    214084 (Slc18a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 D3; 19 54.64 cM
AA seq 517 aa AA seqDB search
MALSDLVLLRWLRDSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNTTEI
QTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDC
PSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFA
FSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPP
FGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIA
AGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR
WLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSV
YGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKE
EKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagcgatctggtgctgctgcgatggctgcgggacagccgccactcgcgcaag
ctgatcctgttcatcgtgttcctcgcgctgctgctagacaacatgctgctcaccgtcgta
gttcccatcattcccagctacctgtacagcattaagcacgagaaaaatactacggaaatc
cagactgccaggccagcgctcacagcctccacttccgaaagcttccacagcatcttctct
tactataacaactctactgtgttcacggggaatgccacggggggcctcccaggaggggag
tcacccaaggctaccaccacacagcacactgtgaccaacacgactgtccctcccgactgc
cccagtgaagacaaagaccttctaaatgagaatgtgcaagttgggctgctgtttgcctcc
aaagccactgtccagctcctcaccaacccattcataggacttctaaccaacagaattggc
tatccaattcccatgtttgctggattctgcattatgtttatctcaacagttatgtttgcc
ttctccagcagctatgccttcctgctgatcgccaggtccctgcagggaatcggctcctct
tgctcatctgtggctgggatgggcatgctggccagcgtgtacacagatgatgaagagagg
ggtaacgccatggggattgctctggggggcctggccatgggggtcttagtgggacccccc
tttggaagtgtgctctatgagtttgtggggaagacagctcctttcctggtgcttgctgcc
ttggtgctcttggatggagctattcagctctttgtgctccagccatcccgagtgcagcca
gaaagtcagaaggggacacctcttacgaccttgctgaaggacccatacattctcatcgct
gcaggctccatctgctttgcaaacatggggatagccatgctggagcccgccctgcccatc
tggatgatggagaccatgtgttcccgaaagtggcagctgggcgttgccttcctgccagcg
agcatctcttatctcattggaaccaatatttttgggatacttgcacacaaaatgggaagg
tggctgtgtgctcttctgggaatgatagttgttgggatcagcattttatgtattcctttt
gcaaaaaatatctacggactcatcgctcccaactttggagttggttttgccattgggatg
gtggactcctccatgatgcctatcatgggctacctggtggacctgcggcacgtgtctgtc
tatgggagtgtgtatgccattgcagatgtagccttctgcatggggtatgctatcggtccc
tctgctggtggtgctattgcaaaggcaattggctttccttggctcatgacaattattggg
ataattgatattgtttttgctccactctgcttttttcttcgaagtccacctgctaaggaa
gaaaaaatggctatcctcatggaccacaactgccccattaagacaaagatgtacactcag
aataatgtccagccgtaccccgtcggtgatgatgaagaatctgagagtgactga

DBGET integrated database retrieval system