KEGG   Mus musculus (mouse): 21423Help
Entry
21423             CDS       T01002                                 

Gene name
Tcf3, A1, AA408400, ALF2, AW209082, E12, E12/E47, E2A, E47, ME2, Pan1, Pan2, TCF-3, Tcfe2a, VDIR, bHLHb21
Definition
transcription factor 3
Orthology
K09063  
transcription factor E2-alpha
Organism
mmu  Mus musculus (mouse)
Pathway
HTLV-I infection
Transcriptional misregulation in cancer
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mmu05202]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10 39.72 cM
AA seq 653 aa AA seqDB search
MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSW
GSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGT
LSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLADTQPKKVRKVPP
GLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGP
MLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSG
TSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQ
GLPGTSQWPRAGAPSALSPNYDAGLHGLQSKMEDRLDEAIHVLRSHAVGTASDLHGLLPG
HGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPD
SYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPE
QKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILS
LEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccagtctcagagaatggcacccgtgggctctgacaaggaactgagtgacctc
ctggacttcagcatgatgttcccgctacctgtggccaatgggaagagccggcccgcctcc
ctcgggggaacccagtttgcaggctcaggactggaggaccgacccagctcaggctcctgg
ggcagcagtgaccagaacagttcttcctttgaccctagccggacatacagcgaaggtgcc
cacttcagtgactcccacagcagcctgccgccttccacgttcctaggagctgggcttgga
ggcaagggcagtgagcggaatgcctatgccacctttgggagagacaccagtgttggcacc
ttgagtcaggctggcttcctgccaggtgagctgagcctcagcagtcccgggccactgtcc
ccatcgggcatcaagagcagctcccagtattacccctcattccccagcaaccctcgtcgg
agagctgcagatggtggcctggcagatactcagccgaagaaggtccggaaggttccgcct
ggtctcccttcctcggtgtatccgcccagctcaggtgacagctacagcagggatgctgca
gcctacccctccgccaagacccccagcagcgcttacccctcccccttctacgtggcagat
ggcagcctgcacccatcagctgagctctggagtacgcctagccaggtgggctttgggccc
atgctaggtgacggctcttcccctctgccccttgcaccgggcagcagctccgtgggcagt
ggtacctttgggggcctccagcagcaggatcgcatgggctaccagctgcatggatctgag
gttaatggctcgctcccagctgtatccagcttttcggctgcccctggcacttacagtggg
acttccggccacacgccccctgtgagtggggccgcagctgaaagcctcctaggcacccga
gggactacagccagcagctcaggggatgcccttgggaaggcactggcctcgatctactcc
ccggatcactccagcaataatttctcacctagcccctcaacgcctgtgggttcaccccag
ggcctgccagggacatcacagtggccccgggcaggagcgcccagtgccttatcccccaac
tacgatgcaggtctccatggcctgcagagcaagatggaggaccgcttggacgaggccatc
catgtcctgcgaagccacgctgttggcaccgctagcgatctccatgggcttttgcctggc
catggcgcactgaccacgagcttcaccggccccatgtcactgggcgggcggcatgccggc
ctggtcgggggaagccatcctgaggagggcctcacaagtggggccagtcttttgcataac
catgccagcctccccagccagcccagttccctccctgacctctcacagagacctcccgac
tcctatagtggactcgggagggcaggcacaacagcgggtgccagcgagatcaagcgggag
gagaaagaggatgaggaaatcgcatcagtagccgacgccgaagaggacaagaaggacctg
aaggtcccacgcacgcgcaccagcccagacgaggacgaggacgaccttctccccccagag
cagaaggcggagcgggagaaggagcgccgggtggccaataatgcccgagagcgcctgcgg
gtccgcgacatcaatgaggcctttaaggagctcggccgcatgtgccagctgcacctcagc
agcgagaagccgcagaccaaactgctcatcctgcaccaggccgtggccgtcatcctcagc
ctggagcagcaggtgcgagaacgcaacctgaaccccaaagcagcctgcttgaagcggagg
gaggaggagaaggtgtctggcgtggtcggggacccacagctggccctgtcagccgcccac
ccgggcctgggtgaggcccacaacccagccgggcacctgtga

DBGET integrated database retrieval system