KEGG   Mus musculus (mouse): 214579Help
Entry
214579            CDS       T01002                                 

Gene name
Aldh5a1, 6330403E24Rik, Ahd-1, Ahd1, D630032B01Rik, OTTMUSG00000000613, SSADH, Ssdh1
Definition
(RefSeq) aldhehyde dehydrogenase family 5, subfamily A1 (EC:1.2.1.24)
  KO
K00139  
succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    214579 (Aldh5a1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    214579 (Aldh5a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     214579 (Aldh5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A3.1; 13 10.77 cM
AA seq 523 aa AA seqDB search
MATCFLLRSFWAARPALPPPGRFRPEPAGTPRRSYASGPGGLHADLLRGDSFVGGRWLPA
PATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFNSWKGVSVKERSLLLRKWYDLMI
QNKDDLAKIITAESGKPLKEAQGEILYSALFLEWFSEEARRIYGDIIYTSAKDKRGLVLK
QPVGVAAIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPYSALALAQLANQAGIPAG
VYNVIPCSRNKAKEVGEVLCTDPLVSKISFTGSTATGKILLHHAANSVKRVSMELGGLAP
FIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDSFVTKFAEAMKKSLRVGN
GFEEGTTQGPLINEKAVEKVEKQVNDAVAKGATVVTGGKRHQSGGNFFEPTLLSNVTRDM
LCITEETFGPLAPVIKFDKEEEAVAIANAAEVGLAGYFYSQDPAQIWRVAEQLEVGMVGV
NEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgctttctgctgcggagcttctgggccgcgcgtcctgcgctgccgcctccc
ggccgcttccgcccggagcccgcaggaaccccgcggcgcagctacgccagcggccccggg
ggcctccacgccgacctactccgcggggacagcttcgtgggcggccgctggctcccagcc
cccgccaccttcccggtgtacgacccggccagcggcgccaagctgggcaccgtggccgac
tgcggggtacccgaggcccgcgctgctgtgcgcgccgcctacgatgccttcaacagctgg
aaaggggtctcggtcaaggagaggagcttactactccgtaaatggtacgacttaatgata
caaaataaggacgaccttgccaagatcataacagccgagagtggaaagccactgaaagag
gcccagggagaaattctgtattcagcccttttcctggagtggttctcagaggaagctcgc
cgtatttatggagacatcatctatacctctgccaaagataagcgagggctagtcctcaag
cagcccgttggtgtggcggccatcatcacaccgtggaattttcccagtgcgatgatcacc
cggaaagtgggggccgccttggcagctggctgcactgtggtggtgaaacctgctgaagac
acaccctattccgccctggccctggctcagcttgcaaaccaggcgggaatccctgcaggt
gtctacaacgtcattccctgctctagaaacaaggccaaggaagtgggagaggtcctgtgt
accgatccattggtgtccaaaatttcctttactggctcaacagcaacgggaaagatcctg
ctacatcacgcagcaaattctgtgaagcgtgtctccatggagttgggtggcctcgcccca
ttcattgtctttgacagtgccaacgtagaccaggccgtcgcgggggcaatggcgtctaaa
tttaggaatgctgggcagacttgcgtttgctcaaacagattcttggtacagcggggtatc
cacgattcctttgtaacgaaatttgcggaagccatgaagaaaagcctgcgtgtaggtaac
ggatttgaggaaggaacgactcaagggccgttaattaatgagaaagctgtagaaaaggta
gagaagcaggtgaatgacgcagttgccaaaggggccacggttgtgacgggcggaaagcga
caccaaagtggaggaaatttctttgagcccaccctgctcagcaatgtcaccagggacatg
ctctgcatcactgaggagacctttggacctctggcaccagtcatcaagtttgataaggag
gaagaggccgtcgccatcgcaaatgcagctgaggttggattggcaggttacttttactct
caagacccggcccagatctggagagtggcggagcagctggaggtcggcatggtcggtgtg
aatgaagggctcatctcttcagtggaatgtccttttggtggggtgaaacagtccggcctt
gggcgcgaggggtccaagtatggcattgacgagtacctagaggtcaagtatgtgtgttac
ggaggcttgtag

DBGET integrated database retrieval system