KEGG   Mus musculus (mouse): 215445Help
Entry
215445            CDS       T01002                                 

Gene name
Rab11fip3, Cart1, D030060O14Rik, Rab11-FIP3, mKIAA0665
Definition
(RefSeq) RAB11 family interacting protein 3 (class II) (EC:2.7.4.6)
  KO
K12485  
Rab11 family-interacting protein 3/4
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    215445 (Rab11fip3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 A3.3
AA seq 1047 aa AA seqDB search
MELCQPTSLSDHDQPASGPQRGVMGLVGPDAPRGWSEEPEEHAQLQRWPEGPNAPICWPE
EVEEPHAPSRWAKEPNAPRCSSQEPDESCHLAEELEESDSPRCWPQEPDTPCHLAKELEE
PDAPRCLPQEPDTPCYLAKELEEPNIPRCWPQEPDVPCHLAKELEEPDAPRCWPQEPDAF
CHLLKEVEEPDALRCWLQGPDAPCHLAKELEDLDSPRCWPQEPDESCHLAKELEEPDAPC
HLAKELEEPDAPRCWPQEPDVPCLLAKKWEESDAPCLLTEELEEPDALHCWPQESEAPCL
LAKELEEPDASHSCPQEADTGCLSAKEPEEPDVSHLWQGVPDAPCLLVKEPEEADALHCC
WPEESEEPDALNPPCFWANEPDEPDPSRCWSEEPQVLCLWPEEQNTKRCWQEEPDAPCFW
PEDREEPIVSCLQFKEPEKPKVRSSWPEELEDCCPTRGLPLEPLLADGELLQACPGPPSD
PGPALSLPSEPGTAQEEGARLRAVFDALDRDGDGFVRIEDFIQFATVYGAEQVKDLTQYL
DPSGLGVISFEDFYQGIVAIRNGDPDGQLYSVEPVQDEETPACADEFDDFVTYEANEVTD
SAYMGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALL
LLPGRSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPSPAKRLSS
RKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGR
LRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQ
QLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERH
QFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRR
LKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEE
INFRLQDYIDRIIVAILETNPSILEVK
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtgccagccgacctccctgtcagaccacgaccagccagcgtctgggccccag
cgtggggtcatggggctggtggggcccgacgctcctcgcggctggtcagaagagcccgag
gaacacgcccagcttcaacggtggccagagggacccaacgcgccaatctgctggcccgag
gaggtagaggagcctcacgctcctagtcgctgggccaaagagcccaatgcccctcgctgc
tcgtcccaggagcccgatgaatcctgtcacttggcagaggagctggaggaatccgactcc
cctcgctgctggccccaggagccagacacaccgtgccacttggccaaggagttggaggaa
cccgacgcccctcgctgcctgccccaggagcccgacacaccgtgctacttggccaaagag
ctagaggaacccaacatccctcggtgctggccccaggagcccgacgtgccgtgccacttg
gccaaggagctagaggaacccgacgcccctcgctgctggccccaggaaccagacgcattc
tgtcacttgctcaaggaggtggaggaacctgatgcccttcgctgctggcttcaagggcca
gacgcaccgtgccacttggccaaggaactggaggacctcgactcccctcgctgctggccc
caggagcccgacgaatcctgtcacttggctaaggagctggaggaaccagacgcaccgtgc
cacttagccaaagagctggaggaacccgacgcccctcgctgctggccccaggagcccgac
gtgccctgtctcttggccaaaaagtgggaggaatccgacgcaccgtgcctcttgacggag
gagctggaagagcctgacgcccttcactgctggccccaggagtcagaggcaccgtgtttg
ttggccaaggagctagaagagcctgatgcctctcacagctgtcctcaggaggcggacaca
gggtgcctctcggccaaggagccagaggagcctgatgtctctcacctgtggcagggggta
cccgatgcaccgtgcctcttggtcaaggaaccagaggaggccgatgcacttcactgttgt
tggcccgaggaatccgaggagccggatgctctcaacccaccgtgtttctgggccaatgaa
ccagacgagcccgatccatcacgatgttggtcagaggagccccaggtgctgtgcctctgg
ccggaggagcagaacacaaagcggtgctggcaggaagagcccgatgcaccctgcttctgg
cccgaggatcgagaggaacccatagtttcgtgtcttcaatttaaagagccagagaagccc
aaagtccggagcagttggcctgaggagctggaagactgctgccctacgcggggcctaccc
cttgagcccttgctcgccgacggcgagctgctgcaggcatgtcccgggccaccctcggac
ccaggaccagcgttgtcgctgcccagcgagcccgggacagctcaggaggagggtgcacgc
ctcagggcggtatttgacgccctggacagagatggggacggcttcgtccgcatcgaggat
ttcatccaattcgccacggtctatggggcagagcaggtgaaggacttaactcagtacctg
gacccgagtgggcttggcgtaatcagctttgaagatttctaccaagggattgtagccatc
agaaatggagatcctgatggccagttgtacagcgtggagcctgtccaagatgaagagacc
cctgcctgtgccgatgagtttgacgactttgtcacctatgaggccaacgaggtgacagac
agtgcatatatggggtctgagagcacctacagtgagtgtgagaccttcacagatgaggac
accagcaccctggtgcaccccgagctgcagcctgaaggggacgtggacagtgctggtggc
tcaggggtgccctctgagtgcctggacaccatggaggagcctgaccatggtgcattgctg
ctgctcccaggcagatcccgcccccacagccaagctgtcgtcatggtgattggcagtgag
gaacattttgaagattatggtgagggcaatgaggcagaactatccccggagaccctctgc
gatggggacggcgaggaccctgcttttctcacccccagcccagccaagcggctctccagc
aggaaggtggcaaggtatctgcaccagtcggggaccctgactatggaggccctggaggac
cctcccccagagcctgtggagtgcccagaggaggacattgcagacaaggtcatcttccta
gagagacgggtgtcagagctggagaaggacagtgcagctgctggcgagcagcatggcagg
ctgaggcaagaaaacctccagctggtgcacagagccaatgccttggaagagcagctgaag
gaacaggagttcagagcccaagagaaggtcctagaagaaaccaggaagcagaaggaactt
ctgtgcaagatggagcgtgagaagagcattgagatcgagaacctgcaggccaggttgcag
cagctggatgaggagaacagtgagctgcggtcctgcacaccctgtctgaaggccaacatc
gagcgccttgaggaggagaagcagaagatgctggatgagattgaggagttgacacagcgg
ctcagtgaggaacaggagaataagaggaaaatgggggacaggctgagccatgagcggcac
caattccagagagacaaggaagcaacccaggagctgatcgaggacctccgcaagcagcta
gaacatctacagctcctcagactggaggtggagcagcgacggggccgcagcagcagcctg
ggcctgcaggagtacaacagccgtgcacgggagagcgagctggagcaggaggtccgcaga
ctcaaacaggacaaccgtaacctgaaggagcaaaatgatgagctaaatgggcagatcatc
accctcagcatccagggtgccaagagcctcttctccacgtctttctcagaatcactggct
gcagaaatcagctctgtctcccgagatgagctcatggaagcaatccagaagcaggaggag
atcaatttccgcctgcaggactacattgacaggatcattgtggccatcctggagaccaac
ccatccatcctagaggtcaagtag

DBGET integrated database retrieval system