KEGG   Mus musculus (mouse): 215855Help
Entry
215855            CDS       T01002                                 

Gene name
Taar6, Gm228, taR-6
Definition
(RefSeq) trace amine-associated receptor 6
  KO
K05051  
trace amine associated receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    215855 (Taar6)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Trace amine
    215855 (Taar6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10; 10 A4
AA seq 345 aa AA seqDB search
MGSNSSPPTVLQLCYENVTGSCVKTPYSPGSRVILYAVFGFGAVLAVFGNLMVMISILHF
KQLHSPTNFLIASLACADFGVGISVMPFSMVRSIESCWYFGRSFCTFHTCCDVAFCYSSL
FHLSFISIDRYIAVTDPLVYPTKFTVSVSGICIGVSWILPLVYSGAVFYTGVYDDGLEEL
SSALNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIENIGSKTES
SSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCA
YYNSAMNPLIYALFYPWFKKAIKVIMSGQVFKNSSATMNLFSEQI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtaactcgtctccgcccaccgtcctgcagctctgctatgagaatgtgaccggg
tcttgtgtgaaaaccccctactctcctgggtcgagggtcatcctctatgcagtctttggc
tttggggctgtgctggcagtgtttggaaacctcatggtgatgatatccatcctccatttc
aagcagctgcactctcccaccaatttcctcattgcatccttggcctgtgctgactttggt
gtgggcatctctgtgatgcccttcagcatggtcaggtccatcgagagctgctggtacttt
ggtagaagtttctgcactttccacacctgctgtgatgtggcgttctgttactcttctctc
ttccacctgagcttcatctccatcgacaggtacatcgctgtcacggaccctctggtctat
cccaccaagttcacggtgtctgtgtctggaatttgcatcggcgtctcctggattctgccc
ctggtgtacagcggcgctgtgttctacacaggggtttatgatgacggcctggaggaatta
tccagtgccctcaactgcgtagggggctgtcaggtagttgtgaatcagaactgggtgctg
atagattttctttccttcttaatacctacacttgttatgataattctgtatggtaatatt
tttctggtagctagacaacaggctaaaaagatagaaaatattgggagcaaaacagaatca
tcctctgagagctacaaagccagagtggcgagaagagaaagaaaagcagccaaaaccctg
gggattaccgtggtagcattcatgatatcatggttgccctacagcattgattcattagtt
gatgcttttatgggcttcatcacccctgcctacatttatgaaatctgtgtttggtgtgct
tattacaactcagccatgaaccctctgatctacgctttattttatccatggtttaagaaa
gctattaaggttattatgagtggccaggtgttcaagaacagctcagccactatgaacttg
ttctctgagcaaatataa

DBGET integrated database retrieval system