KEGG   Mus musculus (mouse): 216238Help
Entry
216238            CDS       T01002                                 

Gene name
Eea1, A430109M19Rik, B230358H09Rik, ZFYVE2
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    216238 (Eea1)
   04145 Phagosome
    216238 (Eea1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    216238 (Eea1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 C3; 10
AA seq 1411 aa AA seqDB search
MFRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
QAVHDAGNDSGHGGEAGLALTRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKSDGLVTDSSAELQALEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EEKSLRAAAEQKVTHLTEDLNKQTTVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSEHAHLEATINQLRSELAKGPQEVAVYVQEIQKLKGSINEL
TQKNQNLTEKLQKKDLDYTHLEEKHNEESASRKTLQASLHQRDLDCQQLQARLTASESSL
QRAQGELSEKAEAAQKLREELREVESTRQHLKVEVKQLQQQREEKEQHGLQLQGEVSQLH
CKLLETERQLGEAHGRLKEQRQLSSEKLMEKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLEKSKQQHQEQQALQQSATAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKGKESVS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHALQQQLTQLTEKLKNQSESHKQAEENLHD
QVQEQKAHLRAAQDRVLSLETSVSELSSQLNESKEKVSQLDIQIKAKTELLLSAEAAKAA
QRADLQNHLDTAQHALQDKQQELNKVSVQLDQLTAKFQEKQEHCIQLESHLKDHKEKHLS
LEQKVEDLEGHIKKLEADALEVKASKEQALQSLQQQRQLSTDLELRNAELSRELQEQEEV
VSCTKLDLQNKSEILENIKQTLTKKEEENVVLKQEFEKLSQDSKTQHKELGDRMQAAVTE
LTAVKAQKDALLAELSTTKEKLSKVSDSLKNSKSEFEKENQKGKAAVLDLEKACKELKHQ
LQVQAESALKEQEDLKKSLEKEKETSQQLKIELNSVKGEVSQAQNTLKQKEKDEQQLQGT
INQLKQSAEQKKKQIEALQGEVKNAVSQKTVLENKLQQQSSQAAQELAAEKGKLSALQSN
YEKCQADLKQLQSDLYGKESELLATRQDLKSVEEKLTLAQEDLISNRNQIGNQNKSIQEL
QAAKASLEQDSAKKEALLKEQSKALEDAQREKSVKEKELVAEKSKLAEMEEIKCRQEKEI
TKLNEELKSHKQESIKEITNLKDAKQLLIQQKLELQGRVDSLKAALEQEKESQQLMREQV
KKEEEKRKEEFSEKEAKLHSEIKEKEAGMKKHEENEAKLTMQVTTLNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKALELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNI
FCAECSTKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaaggatcttgcagaggactcctgggcgagttggctctcaaggttctgattta
gattcatcagcaactcctataaatacggtggatgtcaataatgaaagttcttcagagggt
ttcatatgtccccagtgtatgaaatcccttggctctgctgatgagcttttcaagcactat
caggccgttcatgatgctggtaatgactcgggtcatggtggagaggccggtcttgctttg
acacgagatgacataacactactcagacaagaggtccaagacctacaggcctcacttaag
gaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatatcaagggctacag
cagcaagaggctaaatctgatggattggtgactgattcgtcagcagagctacaggcttta
gagcaacaattagaagaagcacaaacagagaattttaatattaagcaaatgaaagatctg
tttgaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaaatatgat
gaagaaaagagtctccgagcagctgctgaacaaaaagtgacacatttgacagaagactta
aacaaacagacaactgtaattcaagatctgaaaactgaactgcttcagagacctggtata
gaagatgttgctgtactaaagaaagaactggtccaagttcaaacactaatggataacatg
actttggaacgtgagagagaatctgaaaaacttaaagatgaatgcaaaaagttacaatca
gagcatgctcatttggaggctacaataaaccagctaaggagtgaacttgccaaaggcccc
caagaagttgcagtatatgtgcaggaaatacaaaaacttaaaggttcaattaatgaatta
acacaaaaaaaccagaacttgactgaaaaattgcagaagaaagacctagactacacccac
ttagaggagaagcacaatgaagagtcagcaagtcggaagactctccaggcatccctccac
cagcgggacctggattgccagcagcttcaggcaaggctaactgcatctgaaagctcactc
cagagggcccagggagaactcagtgaaaaggcagaggctgctcagaagctcagagaagaa
ctgcgggaagtagagagcacgcgccagcatctcaaggtggaggtgaagcagctgcagcag
cagcgggaagagaaggaacagcacgggctgcagctgcagggggaagtcagccagttacac
tgcaaacttctggagaccgagcgccaactgggggaagctcacggcaggctgaaggaacag
cggcagctttccagcgagaagctgatggaaaaggagcagcaggtggctgacctacagctc
aagctctctcgtctggaggagcagttgaaggaaaaggtaacaaattccactgaattacaa
catcagttagaaaaatcaaagcaacagcatcaagaacagcaagctctacagcaaagtgct
acagccaaactccgagaagctcagaatgatttggagcaagtgttacgtcagattggagat
aaggaccaaaagatccagaaccttgaagccttgctgcagaagggtaaagaaagcgtttcc
ttactagaaaaggaaagagaagatctttatgcaaaaatccaggccggtgaaggagagact
gctgttcttaaccagttacaagagaaaaatcatgcactgcagcagcagctaactcaactg
acggagaagctgaagaatcagtcggaaagccataaacaagccgaggagaacttgcatgac
caggtacaggaacagaaggcacatcttcgagctgcacaagaccgtgttctttctctggaa
accagtgtcagtgaactaagcagtcagttaaatgaaagcaaggagaaggtctcgcagctt
gacatacagattaaagccaaaactgaattattactatcagcagaagcagcaaaagctgct
cagagagctgatcttcagaatcacttggacacagctcaacatgcgttacaggataaacaa
caggagttaaataaggtcagtgtgcagttggatcagctcactgcaaagtttcaggagaag
caggagcattgcattcagctggaaagccaccttaaggatcacaaggagaagcacctctct
ttagaacaaaaagttgaagacttagaaggccacattaagaaactagaagctgatgctctt
gaagttaaagccagcaaggaacaggctttgcagagtctacagcagcagaggcagctgagc
acagacctggagttgagaaatgcagagctgagtagagagctccaggagcaggaggaagta
gtatcttgtacaaaactggatctacagaataaatctgaaatccttgaaaatatcaaacaa
accctcaccaagaaagaagaagaaaatgtcgtcttgaaacaagaatttgaaaagttaagt
caagattcaaagacacagcacaaggagctgggggacaggatgcaagctgcggtcacagag
ctgacagcagtgaaggcacagaaggacgcactcctggccgagctttctacaacaaaagaa
aaactgtcaaaagtttcggattctttaaaaaactccaaaagtgaatttgagaaagaaaat
cagaaaggaaaagctgctgtattagatttggaaaaagcttgtaaagaattaaagcatcag
cttcaagtacaggcagagagtgccctgaaggagcaggaggacctgaaaaagtcactcgag
aaagagaaagagacttctcagcagttgaagatagaactcaattcagtcaagggagaagtc
tcacaggctcaaaatacattaaagcaaaaggagaaagacgaacaacagcttcaggggacc
ataaatcagctaaagcaatcagctgaacaaaagaaaaaacaaattgaagcgcttcaagga
gaggttaaaaatgctgtttcacaaaagacagtgctggagaataagctgcagcagcagtca
tcacaggcagcccaggagcttgcagcagagaaaggaaaactgtcagcgctgcagagcaac
tacgagaagtgccaggcggacctgaaacagctgcagtccgacctctatggcaaagagtct
gaacttctagccacgaggcaagaccttaagtctgtagaagagaagctcactctggcacaa
gaagacttgatttcaaacagaaatcaaattggaaaccaaaataaatcaattcaagaattg
caagccgccaaagctagtttggagcaggactcagcaaagaaagaggcgctgctaaaggag
cagagtaaggcacttgaggatgctcagagagaaaagtcagtgaaggaaaaagaactagta
gctgaaaagtctaaattggcagagatggaggaaattaaatgtagacaagaaaaagaaatc
acaaaactcaatgaggagctcaagtcgcacaaacaagaaagcataaaggaaataacaaat
ctcaaggatgccaagcaacttttgattcaacagaaattagaacttcaaggcagagtggac
tcactgaaggcagctcttgagcaggagaaggagagtcagcagctgatgcgagagcaggtg
aagaaggaggaagagaagcggaaggaagagttttctgagaaggaagcgaagctgcattct
gaaataaaagaaaaggaagcgggaatgaagaaacacgaagaaaacgaggctaagcttact
atgcaggtcacaacattaaatgaaaacttgggtactgtgaagaaggagtggcagtctagt
caacggagagtcagtgagcttgagaagcaaacggatgacttacggggagaaattgctgtc
ttagaagcaactgttcagaataatcaagacgaaagaagagcactcctagagaggtgtctt
aaaggcgaaggtgaaatagaaaagcttcagaccaaagccctagagctgcagagaaagctg
gataacacaactgcggccgtgcaggagctgggcagggagaaccagtctctccagatcaaa
cacacacaagcattgaacagaaagtgggcggaagacaacgaagtgcagaactgcatgtcc
tgtgggaagtgcttctccgtcaccgtgcggcggcatcactgccgacagtgtgggaatatc
ttctgtgccgagtgctcaaccaaaaatgccttaactccttcttcgaagaagcctgttcgt
gtctgtgatgcatgcttcaatgatttgcaaggataa

DBGET integrated database retrieval system