KEGG   Mus musculus (mouse): 216344Help
Entry
216344            CDS       T01002                                 

Gene name
Rab21, 9630024B22
Definition
(RefSeq) RAB21, member RAS oncogene family
  KO
K07890  
Ras-related protein Rab-21
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   216344 (Rab21)
  Exosomal proteins of other body fluids (saliva and urine)
   216344 (Rab21)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab20/21/24 [OT]
    216344 (Rab21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 D1
AA seq 222 aa AA seqDB search
MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLN
IGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLG
NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIE
TAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccggcggcggggcggcggcggcggcgggccgagcctactccttcaaggtg
gtgctgctcggggaaggctgcgtggggaagacgtcgctggtgctgcgctactgcgagaac
aagttcaacgacaagcacatcaccaccctgcaggcatctttcttaacaaagaagttaaat
attggtggaaaaagagtaaaccttgccatatgggacacagcaggtcaggagagattccac
gcactgggcccaatttactaccgagattcgaacggagctattttagtttatgatgtaacg
gatgaagattcctttcagaaggtaaaaaactgggtcaaagaattacgaaaaatgttggga
aatgagatctgtttgtgtatagttggtaataaaatagacttggaaaaggagaggcacgtc
tctattcaagaagcagaatcgtatgcagagtctgtgggagccaagcattaccatacttcc
gctaaacagaacaaaggcattgaggagctctttctcgacctttgtaaaagaatgatagag
acagcccaggtggatgagagagcaaaaggcaatggctcgagtcaagccggggctgcaagg
cgaggtgtgcagatcatcgacgacgagcctcaagctcagagcagcggagggtgctgttcc
tccggctaa

DBGET integrated database retrieval system