KEGG   Mus musculus (mouse): 216456Help
Entry
216456            CDS       T01002                                 

Gene name
Gls2, A330074B06Rik, AI195532, GA, GLS, Lga
Definition
glutaminase 2 (liver, mitochondrial) (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmu00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mmu00471]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:mmu04964]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:mmu04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:mmu04727]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 D3; 10
AA seq 602 aa AA seqDB search
MRSMRALQNALSRAGSHGRRGGWGHPSRGPLLGRGVRYYLGEAAAQGRGTPHSHQPQHSD
HDASHSGMLPRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLQDCMSKMQRMVQ
ESSSGGLLDRELFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKEPTGGKVA
AYIPHLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYHDSYLLSETQAEAAAETLSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgagggctctgcagaacgcgctgagccgcgcgggcagccacggtcggcgg
ggaggctggggtcatccgagccggggcccgcttctgggcaggggcgtccggtactacctc
ggtgaggccgcagcgcagggcagggggacgccgcacagccaccagccgcagcactcggat
catgacgcctcacacagcggcatgctgcctcgacttggtgacctgcttttctacactatt
gcagagggacaggagcgtatccctatccacaagttcaccacggctctgaaggccactgga
ctgcagacgtcagacccacggctccaggactgcatgagcaagatgcagcgcatggtccaa
gagtccagcagcggtggcctcttggaccgagagctcttccaaaagtgtgtgagcagcaac
attgtgctcctgactcaggcattccgaaagaagtttgtcattcctgactttgaggagttc
acgggccatgtggatcgcatatttgaggatgccaaagagcccactggaggcaaagtggca
gcctacatcccgcacctggccaaatcaaacccagacctttggggcgtctccctgtgcact
gtggatgggcagcggcactctgtgggccacacgaagatccccttctgcctgcagtcctgt
gtcaagcccctcacttacgccatctccgtgagcaccttaggcactgactacgtgcacaag
tttgtgggcaaggaacccagtggtctgcgctataacaaactctccctcaatgaggaagga
attccccataaccccatggtcaatgctggtgccattgtggtcagctccctgatcaagatg
gactgtaacaaagcagagaagttcgattttgtgttacagtatctgaacaagatggctggg
aacgaattcatggggttcagcaatgccacattccagtcagagaaggagactggggatcgg
aattacgccatcggctattacctcaaggagaagaagtgcttccctaagggtgtggacatg
atggctgcccttgatctctatttccagctgtgctctgtggaggttacctgtgagtcaggc
agtgtcatggcggccactctggccaatggcggcatctgccctatcacaggggagagcgtg
ctgagcgccgaggccgtgcgcaacaccctcagcctcatgcattcctgtggcatgtatgac
ttctcgggccagtttgccttccatgtgggcctgccagccaagtcagctgtgtcaggagcc
atcctcctggttgtacccaatgtcatgggcatgatgtgtctgtcgccgccgttagacaag
ctggggaacagccaaaggggcatcaacttctgccagaagttggtgtctctctttaacttc
cacaactatgacaacctgcggcactgcgctcggaagttagacccacggagggaaggagga
gaggttcggaacaagaccgtggtgaacctgctatttgctgcatatagtggagatgtctcg
gcccttcgaaggtttgcattgtcggccatggatatggagcagaaggactatgattcccgc
acagccctacatgtcgctgcagctgaagggcacattgaagttgtcaaatttctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggacgatgct
gtgcagttcaaccacctggaggtggtcaaactgcttcaagattaccatgactcctacttg
ctctctgagactcaagctgaggcggcagctgagaccctgtccaaagagaatctagagagc
atggtatga

DBGET integrated database retrieval system