KEGG   Mus musculus (mouse): 216456Help
Entry
216456            CDS       T01002                                 

Gene name
Gls2, A330074B06Rik, AI195532, GA, GLS, Lga
Definition
glutaminase 2 (liver, mitochondrial) (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    216456 (Gls2)
   00330 Arginine and proline metabolism
    216456 (Gls2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    216456 (Gls2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    216456 (Gls2)
  Nervous system
   04724 Glutamatergic synapse
    216456 (Gls2)
   04727 GABAergic synapse
    216456 (Gls2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    216456 (Gls2)
   05206 MicroRNAs in cancer
    216456 (Gls2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     216456 (Gls2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 D3; 10
AA seq 602 aa AA seqDB search
MRSMRALQNALSRAGSHGRRGGWGHPSRGPLLGRGVRYYLGEAAAQGRGTPHSHQPQHSD
HDASHSGMLPRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLQDCMSKMQRMVQ
ESSSGGLLDRELFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKEPTGGKVA
AYIPHLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYHDSYLLSETQAEAAAETLSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgagggctctgcagaacgcgctgagccgcgcgggcagccacggtcggcgg
ggaggctggggtcatccgagccggggcccgcttctgggcaggggcgtccggtactacctc
ggtgaggccgcagcgcagggcagggggacgccgcacagccaccagccgcagcactcggat
catgacgcctcacacagcggcatgctgcctcgacttggtgacctgcttttctacactatt
gcagagggacaggagcgtatccctatccacaagttcaccacggctctgaaggccactgga
ctgcagacgtcagacccacggctccaggactgcatgagcaagatgcagcgcatggtccaa
gagtccagcagcggtggcctcttggaccgagagctcttccaaaagtgtgtgagcagcaac
attgtgctcctgactcaggcattccgaaagaagtttgtcattcctgactttgaggagttc
acgggccatgtggatcgcatatttgaggatgccaaagagcccactggaggcaaagtggca
gcctacatcccgcacctggccaaatcaaacccagacctttggggcgtctccctgtgcact
gtggatgggcagcggcactctgtgggccacacgaagatccccttctgcctgcagtcctgt
gtcaagcccctcacttacgccatctccgtgagcaccttaggcactgactacgtgcacaag
tttgtgggcaaggaacccagtggtctgcgctataacaaactctccctcaatgaggaagga
attccccataaccccatggtcaatgctggtgccattgtggtcagctccctgatcaagatg
gactgtaacaaagcagagaagttcgattttgtgttacagtatctgaacaagatggctggg
aacgaattcatggggttcagcaatgccacattccagtcagagaaggagactggggatcgg
aattacgccatcggctattacctcaaggagaagaagtgcttccctaagggtgtggacatg
atggctgcccttgatctctatttccagctgtgctctgtggaggttacctgtgagtcaggc
agtgtcatggcggccactctggccaatggcggcatctgccctatcacaggggagagcgtg
ctgagcgccgaggccgtgcgcaacaccctcagcctcatgcattcctgtggcatgtatgac
ttctcgggccagtttgccttccatgtgggcctgccagccaagtcagctgtgtcaggagcc
atcctcctggttgtacccaatgtcatgggcatgatgtgtctgtcgccgccgttagacaag
ctggggaacagccaaaggggcatcaacttctgccagaagttggtgtctctctttaacttc
cacaactatgacaacctgcggcactgcgctcggaagttagacccacggagggaaggagga
gaggttcggaacaagaccgtggtgaacctgctatttgctgcatatagtggagatgtctcg
gcccttcgaaggtttgcattgtcggccatggatatggagcagaaggactatgattcccgc
acagccctacatgtcgctgcagctgaagggcacattgaagttgtcaaatttctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggacgatgct
gtgcagttcaaccacctggaggtggtcaaactgcttcaagattaccatgactcctacttg
ctctctgagactcaagctgaggcggcagctgagaccctgtccaaagagaatctagagagc
atggtatga

DBGET integrated database retrieval system