KEGG   Mus musculus (mouse): 216558Help
Entry
216558            CDS       T01002                                 

Gene name
Ugp2, UDPGP, UGPase
Definition
UDP-glucose pyrophosphorylase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    216558 (Ugp2)
   00052 Galactose metabolism
    216558 (Ugp2)
   00500 Starch and sucrose metabolism
    216558 (Ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    216558 (Ugp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     216558 (Ugp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A3.1; 11 13.89 cM
AA seq 497 aa AA seqDB search
MSQDGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGP
SVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIG
VRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQS
RYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSN
IDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVP
KAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETA
VGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVK
LGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPG
AVLENKIVSGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatggtgcttctcagttccaagaggtcattctccaagaactagaattatct
gtgaagaaagaattagaaaaaatacttaccacagcagcctcacatgagtttgagcacact
aaaaaagatcttgatggatttcggaagctatttcatagatttttgcaagaaaagggaccg
tctgtggactggggtaaaatccagagacctccagaagattcgattcaaccctatgaaaag
ataaaagccagaggcttgcctgataacatatcttctgtgttgaacaagttggtggtagtg
aaactcaatggtggtttgggaaccagcatgggctgcaaaggccctaaaagtctgattggt
gtaagaaatgagaacacctttttggatctaactgttcagcaaattgaacatttgaacaaa
acctataatacagatgttcctctcgttttaatgaattcttttaacacggatgaagatacc
aaaaaaatactccagaagtacaatcactgtcgtgtgaaaatctacaccttcaatcaaagc
aggtacccgaggatcaataaggaatctctacttcctatagcaaaggatgtgtcttattca
ggggaaaatactgaagcttggtaccctccagggcatggagatatctatgctagtttctac
aattctggcttgctcgatacctttatagaagaaggcaaagagtatatttttgtgtctaac
atagataatctgggtgccacagtggatctttatattcttaatcacctgatgaacccaccc
aatgggaagcgctgtgagtttgtcatggaagtcacaaacaaaacacgagcagatgttaag
ggtgggacactcactcagtatgaaggcaaactgagactggtggaaatcgctcaagtgccc
aaagcacacgttgatgagttcaagtctgtgtcaaaatttaaaatatttaacacaaacaac
ctatggatttctcttggagcagttaaaagacttcaggaacagaatgccattgacatggaa
atcattgtgaatccaaagacattggatggaggcctgaatgtaattcagttagaaactgca
gttggagctgcaattaaaagtttcgagaattctttaggtattaatgttccaaggagtcgt
tttctgcctgtgaaaaccacatcagatctcttgcttgtgatgtcaaacctctatagcctt
aacgcaggatctctgaccatgagtgaaaagcgtgaattccctacagtgcccttggttaaa
ttaggcagttcttttaccaaggttcaagattatctaagaaggtttgaaagtatacccgat
atgctggaactggaccacctcactgtttcaggagatgtgacatttggaaaaaatgtttca
ctaaagggaacagttattattattgcaaatcatggtgacagaattgacatccccccagga
gccgtgttagagaacaagattgtatctggaaaccttcggatcctggatcactga

DBGET integrated database retrieval system