KEGG   Mus musculus (mouse): 216749Help
Entry
216749            CDS       T01002                                 

Gene name
Nmur2, Nmu2r
Definition
(RefSeq) neuromedin U receptor 2
  KO
K05053  
neuromedin U receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    216749 (Nmur2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuromedin U
    216749 (Nmur2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B1.3
AA seq 395 aa AA seqDB search
MGKLENASWIHDSLMKYLNSTEEYLAYLCGPKRSDLSLPVSVVYALIFVVGVIGNLLVCL
VIARHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVGCYFKTALFET
VCFASILSVTTVSIERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIK
FQQFPNGSSVPGSATCTVTKPIWVYNFIIQATSFLFYILPMTLISVLYYLMGLRLKRDES
LEADKVTVNIHRPSRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVDEWTESLAAVFNLI
HVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVSPSCKWCHPQHRPQGPPAQKVIFLTE
CHLVELTEDAGPQFPCQSSIHNTQLTTVPCVEEVP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacttgaaaatgcttcctggatccacgattctctcatgaagtacttgaacagc
acagaggagtacttggcctacctgtgtggacccaagcgcagtgacctatcccttccagtg
tctgtggtctatgcgctgatcttcgtggtgggggtgataggcaatcttctggtgtgcctg
gtgattgcccgacatcaaactttgaagacacccaccaactactatctcttcagcttggca
gtctcagacttgctggtcctgctcttaggtatgccactggaggtctacgagttgtggcac
aattatcccttcctgtttgggccggtgggatgctacttcaagacagcccttttcgagact
gtgtgctttgcctccattctcagtgtcaccacggttagcattgagcgctacgtggccatt
gtccatccgttccgagccaagctggagagcacacggcgacgggccctcaggatcctcagc
ctagtctggagcttctctgtggtcttttctttgcccaacaccagcatccatggcatcaag
ttccagcagtttcccaacgggtcctctgtgcccggctctgccacctgcacagtcaccaaa
cccatatgggtgtataacttcatcatccaagctacctccttcctcttctacatcctcccg
atgaccctcatcagcgtcctctactatctcatggggctcaggctgaagagagatgaatct
cttgaggcagacaaagtgactgtgaatattcacagaccctccagaaaatcagtcaccaag
atgctgtttgtcttggtcctcgtgtttgctatctgttggacccctttccatgtggacagg
ctcttcttcagctttgtggacgagtggactgagtccctggctgctgtgttcaacctcatc
cacgtggtatcaggtgtctttttctatctgagctccgctgtcaaccccattatatataac
ctcctgtctcggcgcttccgggcggcctttcggaatgttgtctctccttcctgcaaatgg
tgccatccccagcatcgcccacaggggcctccagcccagaaggttatcttcttgacagaa
tgccaccttgtggagctgacagaggatgcgggcccccagttcccttgtcagtcatccatc
cacaacacccaacttaccaccgtcccctgtgttgaagaggtaccatga

DBGET integrated database retrieval system