KEGG   Mus musculus (mouse): 216825Help
Entry
216825            CDS       T01002                                 

Gene name
Usp22, AI427806
Definition
(RefSeq) ubiquitin specific peptidase 22
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     216825 (Usp22)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   216825 (Usp22)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     216825 (Usp22)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    216825 (Usp22)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     216825 (Usp22)
    SLIK complex
     216825 (Usp22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 216825
NCBI-ProteinID: NP_001004143
MGI: 2144157
Ensembl: ENSMUSG00000042506
Vega: OTTMUSG00000005825
UniProt: Q5DU02
Position
11; 11 B2
AA seq 525 aa AA seqDB search
MVARPEPEVEAMDAELAVPPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CVCHVCGIHLNRLHSCLYCVFFGCFTKKHIHDHAKSKRHNLAIDLMYGGIYCFLCQDYIY
DKDIEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVVNGESHASGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPLDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaggccggagcctgaggtcgaggccatggacgctgagctggcggtaccgccg
cctggctgctcgcacctgggcagcttcaaggtggacaactggaagcaaaacctgcgggcc
atctaccagtgcttcgtgtggagcggaactgccgaggctcgcaagcgcaaggcaaagtcc
tgtgtctgccatgtctgcggcatccacctgaaccggctgcactcttgcctctactgtgtc
ttctttggctgtttcacgaagaagcacatccatgaccatgccaagtcaaagcgacacaac
ctggccatcgacctgatgtacggaggtatttactgcttcttgtgtcaggactacatctat
gacaaagacatagaaatcattgccaaagaggagcagcgcaaggcttggaagatgcaaggt
gttggagagaagttttcaacttgggaaccaactaaacgggagctggaactgctgaagcat
aacccaaagaggcggaagatcacctccaattgtaccataggtctgcgtggactgatcaac
ctggggaacacgtgtttcatgaactgcatcgtgcaggcgctgacccacactccgctcctg
agagacttctttctgtcggataggcaccgctgtgagatgcagagccccagctcctgcttg
gtctgtgagatgtcctctctcttccaggagttttactcagggcaccgctccccacacatt
ccatacaagctgctgcacctggtgtggacgcacgcccggcacctggcgggttatgagcag
caggacgcacatgagttcctcattgcagccctggacgtcctccaccggcactgcaaaggt
gatgacaatgggaagaaagccaacaatcctaaccactgcaattgcatcattgaccagatc
tttacgggtgggctccagtctgatgttacatgccaagtctgccacggggtctccaccacc
atagaccccttctgggacatcagtttagaccttcccggttcttctaccccattctggccc
ttgagcccagggagcgagggcagtgtggttaatggggagagccatgcatccgggaccacc
actctcacagactgcctgcgaagatttaccagaccagagcacttaggaagcagtgccaag
atcaagtgtagcggttgccatagctaccaagagtccacaaagcagctcaccatgaagaag
ctgcccattgtggcctgtttccatctcaaacgatttgaacactcagccaaacttcggcgg
aagatcaccacatatgtgtcttttcccctggaactggacatgacgcccttcatggcctcc
agcaaagagagcaggatgaatgggcaataccagcagcccctggacagtctcaacaatgac
aacaaatactccctgtttgctgtcgttaaccatcaagggaccttggagagtggccactac
accagcttcatccggcagcacaaagaccagtggttcaagtgtgatgacgccattatcacc
aaggccagcatcaaagatgtactggacagtgaagggtacctactcttctatcacaaacag
ttcctggaatacgagtag

DBGET integrated database retrieval system