KEGG   Mus musculus (mouse): 216825Help
Entry
216825            CDS       T01002                                 

Gene name
Usp22, AI427806
Definition
ubiquitin specific peptidase 22 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B2; 11
AA seq 525 aa AA seqDB search
MVARPEPEVEAMDAELAVPPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CVCHVCGIHLNRLHSCLYCVFFGCFTKKHIHDHAKSKRHNLAIDLMYGGIYCFLCQDYIY
DKDIEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVVNGESHASGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPLDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaggccggagcctgaggtcgaggccatggacgctgagctggcggtaccgccg
cctggctgctcgcacctgggcagcttcaaggtggacaactggaagcaaaacctgcgggcc
atctaccagtgcttcgtgtggagcggaactgccgaggctcgcaagcgcaaggcaaagtcc
tgtgtctgccatgtctgcggcatccacctgaaccggctgcactcttgcctctactgtgtc
ttctttggctgtttcacgaagaagcacatccatgaccatgccaagtcaaagcgacacaac
ctggccatcgacctgatgtacggaggtatttactgcttcttgtgtcaggactacatctat
gacaaagacatagaaatcattgccaaagaggagcagcgcaaggcttggaagatgcaaggt
gttggagagaagttttcaacttgggaaccaactaaacgggagctggaactgctgaagcat
aacccaaagaggcggaagatcacctccaattgtaccataggtctgcgtggactgatcaac
ctggggaacacgtgtttcatgaactgcatcgtgcaggcgctgacccacactccgctcctg
agagacttctttctgtcggataggcaccgctgtgagatgcagagccccagctcctgcttg
gtctgtgagatgtcctctctcttccaggagttttactcagggcaccgctccccacacatt
ccatacaagctgctgcacctggtgtggacgcacgcccggcacctggcgggttatgagcag
caggacgcacatgagttcctcattgcagccctggacgtcctccaccggcactgcaaaggt
gatgacaatgggaagaaagccaacaatcctaaccactgcaattgcatcattgaccagatc
tttacgggtgggctccagtctgatgttacatgccaagtctgccacggggtctccaccacc
atagaccccttctgggacatcagtttagaccttcccggttcttctaccccattctggccc
ttgagcccagggagcgagggcagtgtggttaatggggagagccatgcatccgggaccacc
actctcacagactgcctgcgaagatttaccagaccagagcacttaggaagcagtgccaag
atcaagtgtagcggttgccatagctaccaagagtccacaaagcagctcaccatgaagaag
ctgcccattgtggcctgtttccatctcaaacgatttgaacactcagccaaacttcggcgg
aagatcaccacatatgtgtcttttcccctggaactggacatgacgcccttcatggcctcc
agcaaagagagcaggatgaatgggcaataccagcagcccctggacagtctcaacaatgac
aacaaatactccctgtttgctgtcgttaaccatcaagggaccttggagagtggccactac
accagcttcatccggcagcacaaagaccagtggttcaagtgtgatgacgccattatcacc
aaggccagcatcaaagatgtactggacagtgaagggtacctactcttctatcacaaacag
ttcctggaatacgagtag

DBGET integrated database retrieval system