KEGG   Mus musculus (mouse): 21687Help
Entry
21687             CDS       T01002                                 

Gene name
Tek, AA517024, Cd202b, Hyk, STK1, Tie-2, Tie2
Definition
(RefSeq) endothelial-specific receptor tyrosine kinase (EC:2.7.10.1)
  KO
K05121  
endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    21687 (Tek)
   04015 Rap1 signaling pathway
    21687 (Tek)
   04066 HIF-1 signaling pathway
    21687 (Tek)
   04151 PI3K-Akt signaling pathway
    21687 (Tek)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    21687 (Tek)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     21687 (Tek)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Tie family
   21687 (Tek)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class XI (TIE receptor family)
   21687 (Tek)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class XI (TIE receptor family)
   21687 (Tek)
Cellular antigens [BR:mmu04090]
 Proteins
  21687 (Tek)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C5; 4 43.34 cM
AA seq 1122 aa AA seqDB search
MDSLAGLVLCGVSLLLYGVVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGEC
ICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNE
ACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIE
VNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKK
LFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIG
LPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVL
LSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTI
VDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSS
NPAFSHELRTLPHSPASADLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRM
AQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKAR
IKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAI
EYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIH
RDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVW
SYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYER
PSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atggactctttagccggcttagttctctgtggagtcagcttgctcctttatggagtagta
gaaggcgccatggacctgatcttgatcaattccctacctcttgtgtctgatgccgaaaca
tccctcacctgcattgcctctgggtggcacccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaagatccactggaggttactcaagatgtgaccaga
gaatgggcgaaaaaagttgtttggaagagagaaaaggccagtaagattaatggtgcttat
ttctgtgaaggtcgagttcgaggacaggctataaggatacggaccatgaagatgcgtcaa
caagcatccttcctacctgctactttaactatgaccgtggacaggggagataatgtgaac
atatctttcaaaaaggtgttaattaaagaagaagatgcagtgatttacaaaaatggctcc
ttcatccactcagtgccccggcatgaagtacctgatattttagaagttcacttgccgcat
gctcagccccaggatgctggtgtgtactcggccaggtacataggaggaaacctgttcacc
tcagccttcaccaggctgattgttcggagatgtgaagctcagaagtgggggcccgactgt
agccgtccttgtactacttgcaagaacaatggagtctgccatgaagataccggggaatgc
atttgccctcctgggtttatggggagaacatgtgagaaagcttgtgagccgcacacattt
ggcaggacctgtaaagaaaggtgtagtggaccagaaggatgcaagtcttatgtgttctgt
ctcccagacccttacgggtgttcctgtgccacaggctggagggggttgcagtgcaatgaa
gcatgcccatctggttactacggaccagactgtaagctcaggtgccactgtaccaatgaa
gagatatgtgatcggttccaaggatgcctctgctctcaaggatggcaagggctgcagtgt
gagaaagaaggcaggccaaggatgactccacagatagaggatttgccagatcacattgaa
gtaaacagtggaaaatttaaccccatctgcaaagcctctgggtggccactacctactagt
gaagaaatgaccctagtgaagccagatgggacagtgctccaaccaaatgacttcaactat
acagatcgtttctcagtggccatattcactgtcaaccgagtcttacctcctgactcagga
gtctgggtctgcagtgtgaacacagtggctgggatggtggaaaagcctttcaacatttcc
gtcaaagttcttccagagcccctgcacgccccaaatgtgattgacactggacataacttt
gctatcatcaatatcagctctgagccttactttggggatggacccatcaaatccaagaag
cttttctataaacctgtcaatcaggcctggaaatacattgaagtgacgaatgagattttc
actctcaactacttggagccgcggactgactacgagctgtgtgtgcagctggcccgtcct
ggagagggtggagaagggcatcctgggcctgtgagacgatttacaacagcgtctatcgga
ctccctcctccaagaggtctcagtctcctgccaaaaagccagacagctctaaatttgact
tggcaaccgatatttacaaactcagaagatgaattttatgtggaagtcgagaggcgatcc
ctgcaaacaacaagtgatcagcagaacatcaaagtgcctgggaacctgacctcggtgcta
ctgagcaacttagtccccagggagcagtacacagtccgagctagagtcaacaccaaggcg
cagggggagtggagtgaagaactcagggcctggacccttagtgacattctccctcctcaa
ccagaaaacatcaagatctccaacatcactgactccacagctatggtttcttggacaata
gtggatggctattcgatttcttccatcatcatccggtataaggttcagggcaaaaatgaa
gaccagcacattgatgtgaagatcaagaatgctaccgttactcagtaccagctcaagggc
ctagagccagagactacataccatgtggatatttttgctgagaacaacataggatcaagc
aacccagccttttctcatgaactgaggacgcttccacattccccagcctctgcagacctc
ggagggggaaagatgctactcatagccatccttgggtcggctggaatgacttgcatcacc
gtgctgttggcgtttctgattatgttgcaactgaagagagcaaatgtccaaaggagaatg
gctcaggcattccagaacagagaagaaccagctgtgcagtttaactcaggaactctggcc
cttaacaggaaggccaaaaacaatccggatcccacaatttatcctgtgcttgactggaat
gacatcaagtttcaagacgtgatcggagagggcaactttggccaggttctgaaggcacgc
atcaagaaggatgggttacggatggatgccgccatcaagaggatgaaagagtatgcctcc
aaagatgatcacagggacttcgcaggagaactggaggttctttgtaaacttggacaccat
ccaaacatcattaatctcttgggagcatgtgaacaccgaggctatttgtacctagctatt
gagtatgccccgcatggaaacctcctggacttcctgcgtaagagcagagtgctagagaca
gaccctgcttttgccatcgccaacagtacagcttccacactgtcctcccaacagcttctt
cattttgctgcagatgtggcccgggggatggactacttgagccagaaacagtttatccac
agggacctggctgccagaaacattttagttggtgaaaactacatagccaaaatagcagat
tttggattgtcacgaggtcaagaagtgtatgtgaaaaagacaatgggaaggctcccagtg
cgttggatggcaatcgaatcactgaactatagtgtctatacaaccaacagtgatgtctgg
tcctatggtgtattgctctgggagattgttagcttaggaggcaccccctactgcggcatg
acgtgcgcggagctctatgagaagctaccccagggctacaggctggagaagcccctgaac
tgtgatgatgaggtgtatgatctaatgagacagtgctggagggagaagccttatgagaga
ccatcatttgcccagatattggtgtccttaaacaggatgctggaagaacggaagacatac
gtgaacaccacactgtatgagaagtttacctatgcaggaattgactgctctgcggaagaa
gcagcctag

DBGET integrated database retrieval system