KEGG   Mus musculus (mouse): 217127Help
Entry
217127            CDS       T01002                                 

Gene name
Kat7, Hbo1, Hboa, Myst2
Definition
K(lysine) acetyltransferase 7 (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     217127 (Kat7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D; 11
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLPSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagagaaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcatacagacagttcagagagtgatggcacctcgcgccgatctgcc
cgagtcacccgctcctcagccaggctaagccagagttcccaagattccagccctgttcga
aatttgccgtctttcggcactgaggagcctgcctattctaccagaagggtgacccgtagt
cagcagcagcccacgccagtgactccaaaaaagtaccctcttcgacagactcgctcatct
ggctctgaaacggagcaggtggtggacttttcagatagagaaactaaaaatacagctgat
catgatgagtcaccacctcgaactccaaccggaaatgcaccttcttctgagtctgacata
gacatctccagccccaacgtgtctcatgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcaccgtcccaagcgacgtcgatttcacgaaagctacaat
ttcaacatgaagtgtcctacgccgggctgcaactctctaggacatcttacaggaaagcac
gagagacatttctccatctcaggatgcccgctgtatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacagagagacagctgcggtat
aaggaaaaggtggctgaactcaggaagaaaagaaattctggactgagcaaagagcagaag
gagaaatacatggaacacagacagacctatgggaacactcgggagcctctcttggaaaac
ctgacaagtgaatatgacttagatcttttccgaagagcacaagcccgggcttctgaggat
ttggagaagttaaggcttcaaggccaaatcacagagggaagcaacatgattaaaacaatt
gcttttggccgctatgaactggacacttggtaccactctccctatcctgaggaatatgcg
aggctgggacgtctctacatgtgtgaattctgcttaaagtacatgaagagccagacaatc
ctccgccgacacatggccaagtgtgtgtggaaacacccccctggtgatgagatttatcgc
aaaggctccatctctgtgtttgaagtagacggcaagaagaacaagatctactgccaaaac
ctctgccttttggcaaagctttttctggaccataagacgctatactatgatgtagaacct
ttcctgttctacgttatgacagaagcggacaatactggctgtcatctgattggatatttt
tctaaggagaagaattcatttctcaactataatgtctcgtgcatcctcaccatgcctcag
tacatgcgacagggctacgggaagatgctgatcgatttcagttatttactttccaaagta
gaagagaaagtcggctctccagagcgcccactgtcagacctggggctcataagctaccgc
agctactggaaggaggtactgctccgatacctgcacaacttccagggcaaggagatctcc
atcaaagaaattagccaggaaacagctgtgaatcccgtggacattgtcagcactctgcaa
gcccttcagatgctcaagtattggaaaggcaagcacctagttttaaagagacaggacctg
atagatgagtggatagccaaagaggccaaaaggtccaactccaacaaaaccatggatcca
agctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system