KEGG   Mus musculus (mouse): 217232Help
Entry
217232            CDS       T01002                                 

Gene name
Cdc27, AI452358, APC3, BC023187
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    217232 (Cdc27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    217232 (Cdc27)
   04114 Oocyte meiosis
    217232 (Cdc27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    217232 (Cdc27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    217232 (Cdc27)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     217232 (Cdc27)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     217232 (Cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 67.79 cM
AA seq 830 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSTVI
SPDNVPLGPGTAILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVAPTGAPTKKTFCVLQSVARMGQTGTKSVFSQSGNSREVTPVLVAQTQSSG
PQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKT
NKGGLTQPSINDSLEITKLDSSIISEGKITTVTPQIQAFNLQKAAAGLMSLLREMGKGYL
ALCSYNCKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVE
GMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAI
QVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLA
EMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLF
ANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQ
IKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcgctaaaccactatgct
taccgagatgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttttactggcaacctgttactaccgctcaggaaaggcttataaagcatatagactc
ttgaaaggacacagttgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgacgaccttgtcactgagtttggagattcagcttgcttcactctttccttg
ttgggacatgtgtattgcaagacagatcggcttgccaaagggtcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacttgtacaactctagtatctaatcacagtttatctcacagacagcctgagaca
gtccttacagaaacaccccaagacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcaactgtaatt
tcaccagataacgtcccccttggacctggtactgccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgatgtggcacccaccggagcacctacaaaaaagact
ttttgtgttttacagtctgttgcaagaatgggccaaactggaacaaagtctgtcttctca
cagagtggaaatagtcgagaggtcacaccagtacttgttgcacaaacacaaagttctggc
ccacaaacaagtacaacacctcaggtattgagccccactatcacatctcccccaaacgca
ttgcctcggagaagttcccgccttttcactagtgacagttctacaaccaaggagaatagc
aaaaagttaaaaatgaagtttccacctaaaatccctaacagaaaaacaaaaagtaaaact
aataaaggaggactaactcagcccagcataaacgatagtctggaaattacaaaactggac
tcctctatcatttcagaagggaaaataaccacagtcacacctcagatccaggcatttaac
ctacaaaaggcagcagcaggtttgatgagccttcttcgtgaaatgggaaaaggttattta
gctttgtgttcatacaactgcaaagaagctatcaatattttgagccatctaccttctcat
cactacagtactggttgggtcctatgccagattggacgggcttattttgaactttcagaa
tacatgcaggctgaaagaatattctcagaggttagaaggattgagagtttcagagttgaa
ggaatggagatctactctacaacactctggcatcttcagaaagacgttgctctttcagtt
ctttcaaaagatttaacagacatggataagaattcaccagaggcctggtgtgctgcaggg
aattgtttcagtctacaacgagagcatgatatagcaattaaattcttccaaagagctatc
caggtcgatccaaattacgcttacgcctatactctattaggacatgagtttgtgttaact
gaagaactagataaagcattagcatgttttcgaaatgctataagagtaaatcccagacat
tacaatgcatggtatggtttaggaatgatttattacaagcaagagaagttcagcctcgca
gaaatgcatttccagaaagcacttgatatcaaccctcagagttcagttttactttgccac
attggagtagttcagcatgcactaaagaagtctgagaaggctttggataccctaaacaaa
gccattgttatcgatcccaagaaccctctatgcaaatttcacagagcctcggttttattt
gcaaatgaaaaatacaagtctgctttacaagaactcgaggaactgaagcagattgtcccc
aaagagtccctcgtttacttcctaataggaaaggtttacaagaagttgggtcaaactcat
ctcgccttgatgaatttctcttgggctatggatttagatcctaaaggagccaataatcag
attaaagaggcaattgacaagcgctaccttccagatgatgaggagccaataacccaggag
gaacagatcatggggacagatgaatcccaggagagcagcatgacagatgcagatgacaca
caacttcatgcggcggaaagtgacgaattttaa

DBGET integrated database retrieval system