KEGG   Mus musculus (mouse): 217232Help
Entry
217232            CDS       T01002                                 

Gene name
Cdc27, AI452358, APC3, BC023187
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mmu04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mmu04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mmu04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:mmu04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 67.79 cM
AA seq 830 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSTVI
SPDNVPLGPGTAILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVAPTGAPTKKTFCVLQSVARMGQTGTKSVFSQSGNSREVTPVLVAQTQSSG
PQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKT
NKGGLTQPSINDSLEITKLDSSIISEGKITTVTPQIQAFNLQKAAAGLMSLLREMGKGYL
ALCSYNCKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVE
GMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAI
QVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLA
EMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLF
ANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQ
IKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcgctaaaccactatgct
taccgagatgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttttactggcaacctgttactaccgctcaggaaaggcttataaagcatatagactc
ttgaaaggacacagttgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgacgaccttgtcactgagtttggagattcagcttgcttcactctttccttg
ttgggacatgtgtattgcaagacagatcggcttgccaaagggtcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacttgtacaactctagtatctaatcacagtttatctcacagacagcctgagaca
gtccttacagaaacaccccaagacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcaactgtaatt
tcaccagataacgtcccccttggacctggtactgccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgatgtggcacccaccggagcacctacaaaaaagact
ttttgtgttttacagtctgttgcaagaatgggccaaactggaacaaagtctgtcttctca
cagagtggaaatagtcgagaggtcacaccagtacttgttgcacaaacacaaagttctggc
ccacaaacaagtacaacacctcaggtattgagccccactatcacatctcccccaaacgca
ttgcctcggagaagttcccgccttttcactagtgacagttctacaaccaaggagaatagc
aaaaagttaaaaatgaagtttccacctaaaatccctaacagaaaaacaaaaagtaaaact
aataaaggaggactaactcagcccagcataaacgatagtctggaaattacaaaactggac
tcctctatcatttcagaagggaaaataaccacagtcacacctcagatccaggcatttaac
ctacaaaaggcagcagcaggtttgatgagccttcttcgtgaaatgggaaaaggttattta
gctttgtgttcatacaactgcaaagaagctatcaatattttgagccatctaccttctcat
cactacagtactggttgggtcctatgccagattggacgggcttattttgaactttcagaa
tacatgcaggctgaaagaatattctcagaggttagaaggattgagagtttcagagttgaa
ggaatggagatctactctacaacactctggcatcttcagaaagacgttgctctttcagtt
ctttcaaaagatttaacagacatggataagaattcaccagaggcctggtgtgctgcaggg
aattgtttcagtctacaacgagagcatgatatagcaattaaattcttccaaagagctatc
caggtcgatccaaattacgcttacgcctatactctattaggacatgagtttgtgttaact
gaagaactagataaagcattagcatgttttcgaaatgctataagagtaaatcccagacat
tacaatgcatggtatggtttaggaatgatttattacaagcaagagaagttcagcctcgca
gaaatgcatttccagaaagcacttgatatcaaccctcagagttcagttttactttgccac
attggagtagttcagcatgcactaaagaagtctgagaaggctttggataccctaaacaaa
gccattgttatcgatcccaagaaccctctatgcaaatttcacagagcctcggttttattt
gcaaatgaaaaatacaagtctgctttacaagaactcgaggaactgaagcagattgtcccc
aaagagtccctcgtttacttcctaataggaaaggtttacaagaagttgggtcaaactcat
ctcgccttgatgaatttctcttgggctatggatttagatcctaaaggagccaataatcag
attaaagaggcaattgacaagcgctaccttccagatgatgaggagccaataacccaggag
gaacagatcatggggacagatgaatcccaggagagcagcatgacagatgcagatgacaca
caacttcatgcggcggaaagtgacgaattttaa

DBGET integrated database retrieval system