KEGG   Mus musculus (mouse): 217258Help
Entry
217258            CDS       T01002                                 

Gene name
Abca8a
Definition
ATP-binding cassette, sub-family A (ABC1), member 8a
Orthology
K05650  
ATP-binding cassette, subfamily A (ABC1), member 8
Organism
mmu  Mus musculus (mouse)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    217258 (Abca8a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11
AA seq 1619 aa AA seqDB search
MVKREINVCQQTWALLCKNLLRKKRLKRDTFLEFLYTALILLSLILFLQLHEVYDFSSLP
DVDLGRIDSFNDSTFMIVYTPITPTTQRIMDRVSLVSYMTGRKILASPNEENMTELISMR
FSDVVGVIFTNAYSYNLKFIKGARIPTIKEHQDHTAHCHSYGEIIYCGLSEFWRDGFVAL
QAAINAAIIEVTTNHSVMEEMMSLTGKYIKIDSFVGQEGTTTDCFLFFCIIRFSPLTYYI
SAGVTRERKKMKGLMAVMGLRDSAFWLSWGLLYGVIVFVVTLLSTTIVKLVQFVFLTGFM
VIFSLFFFYGLSLISLSFLMSVLLKKSFLTDLVVFLLTVSCGSLGFTALYRYLPVSLEWL
LSLLSPFAFMLGMVQLLRLDYDVNSNADPMGNPNEVIGTIFMLFFDGVFYLLLTFYFEKV
LPSEYGRRHPPLFFLKSSFWSGQNPANRTALDNETDYEFSDDSFEPVSMEFHGKEAIRIR
NLTKDYIQKSKRTEALKDLTLDVYKGQITAILGHSGAGKSTLLNVLSGLCVPTKGWVTIH
NNKLSEMTDLENISKLTGVCPQCNVQFDFLTVRENLRLFAKIKGIQAHEVDNEVQRVLLE
LDMKNTQNILVQNLSGGQKRKLTFGIAILGDPQIFLLDEPTAGLDPFSRHRVWNFLKERR
ADRVVLFSTQFMDEADILADRKVFISKGKLKCAGSSLFLKKKWGIGYHLSLQLSETCVHE
RITSLVKQHIPDSKLSAESEGKLSYILPLERTNKFPDLYRDLERSPDLGIENYGVSITTL
TEVFLKLEGKSSIDQSDIGMTEDVQAGGARSPERFAEVEQLVSLLNGRCKMKGGMALWWQ
QLCAVTRLRFLKLKHERKSIVILILVLGIGLLHILSANIYRMVRQSDYCWELAPHMYFLT
PGQQPQPPLTNLLIVNKTGAKIDDFIHSLEQQNIALEVDAFGTRNGTEDSQYNGAIILSG
DEKNYNFTLACNTKRLNCFPVLVDIVSNGLLGLFAPSAHIQTDRSTFPEENDHRKFDYLA
YFFLWVLLMACVPPYISMTSIDDYKNRAQFQLWISGLSPSAYWFGQALFEVPVYCALILS
IFIAFYASAPPESKFTVGDLFIQILYVGGYAMSVIFMTYVISFIYRKGRKNSGLWSLCFY
IVSFFSMCFMLIDYFRDISLFVLIALVPPATLGGCTLLHFENREFSEIIFEPEREYSYLF
FLAPLLHFAIFVVILRCMERKFGMKTMRTDPVFRISPRSDRVFNNPEDPDGEDEDVSQER
VWTANALTSADFQEKPAIIASCLRKEYKGKKKCFVLKSKKKIATRNISFCVRKGEVVGLL
GHNGAGKSTSIKMITGETKPSAGQVLLKGSSTGDTPGFLGYCPQENALWLNLTVREHLEI
FAAIKGMRKSDANVAIERLADALKLQDQLKSPVKTLSEGVKRKLCFVLSILGNPSVVLLD
EPSTGMDPEGQQQMWQAIQATFSNTERGALLTTHYMAEAEAVCDRVAIMVSGRLRCIGSI
QHLKSKFGKEYLLEMKVKTPSQVEPLNTEIMRLFPQAARQERYSSLMVYKLPREDVQPLS
QAFFKLETVKQSFDLEEYSLSQSTLEQVFLELSKEQELDGFEEELDPSVKWKLLPQEEA
NT seq 4860 nt NT seq  +upstreamnt  +downstreamnt
atggttaagagagagataaatgtgtgccaacaaacgtgggccttattgtgcaagaatctt
ctcagaaaaaagagactgaaaagagatacatttttggaattcctgtacacagcacttata
ctacttagtttaattttatttcttcaattgcatgaagtttatgatttttcgtcactgcct
gatgtggacctgggacgcattgattcatttaatgactccacctttatgattgtgtacaca
cctatcaccccaacaactcagaggataatggatagagtctctttggtctcttacatgaca
ggaagaaaaatattggcttctccgaatgaagaaaatatgacagaactcatttcaatgcgt
ttcagtgatgtagtgggggtcatattcaccaacgcttactcctacaacttgaagttcata
aaaggagcaaggatccccaccataaaggagcatcaggaccacacagctcattgtcattcc
tatggagagatcatttattgtggcctttcagaattctggagagatgggtttgtggctctt
caagctgccattaacgctgccatcatagaagtcacaacaaatcactcagtgatggaagag
atgatgtcacttaccggaaaatacatcaagatagattctttcgttgggcaagaagggaca
acgacagactgcttcctttttttctgtatcattcgtttctccccacttacctattatatc
tcagctggtgttacaagagaaaggaaaaagatgaagggcttgatggcagtgatgggcctt
cgggattcagcattctggctgtcctggggtttgctctatggtgtcattgtcttcgttgtg
acccttctctcgacaactattgtaaaactggtccaatttgtctttttgactggatttatg
gtgatcttcagtctctttttcttctatggcttatctctgatctctttgtctttcttgatg
agtgttttactaaagaagtcttttctcactgacctggtggtgttcttgctcactgtttcc
tgtggaagtcttggattcacagcattgtacagataccttcctgtatccttggagtggctt
ctaagtttgctcagtccctttgcttttatgcttggaatggtccagctcttacgtttagat
tatgatgtgaattcaaatgcagaccccatgggcaacccaaatgaagtcattggcacaatc
ttcatgctgttctttgatggtgtcttctacctgctcttgacattctactttgagaaggtt
ttaccaagtgaatatggacgtcgacacccacccttgtttttcctgaagtcctcattttgg
tcaggacaaaatccagccaatcggactgcccttgacaatgaaacagactatgagttttct
gatgactcttttgaacctgtgtctatggaattccatgggaaggaagccatcagaatcaga
aatcttacaaaagactacatacaaaagtctaagcgcacagaagctttgaaagatctgaca
ctggatgtatataaaggccagattactgcgatccttggtcacagtggagctgggaaatca
acactgttaaatgtcctgagtgggttgtgtgttcccaccaaaggttgggtcactatccat
aataacaaactctcagaaatgactgacttggaaaatatcagcaagctcactggagtttgt
ccacaatgcaatgtgcaatttgacttcctcactgtaagagaaaatcttaggctatttgct
aaaataaaagggattcaagcccacgaagtggataacgaggtacaaagagttttgctggaa
ttggacatgaaaaatactcagaatattcttgttcaaaacctaagcggcggacagaagaga
aagctgacgtttggaatcgccattttaggagaccctcagattttcctactggatgagccc
accgctggcctggatcccttttcaaggcaccgggtgtggaatttcctgaaggagcgcaga
gcagaccgtgtggtcctcttcagcacgcagttcatggatgaggctgacatcctggctgat
aggaaagtgttcatctccaaggggaagctgaagtgtgcaggatcttctttgtttctgaag
aagaaatgggggattggttatcacttaagcttgcagctgagtgaaacgtgtgtgcatgaa
agaataacatcacttgtcaaacagcacatccccgattccaagttgtcagcagaaagcgaa
gggaaactgagctacatattacccctggaaagaacaaacaagtttccagatctttatagg
gatctcgagagaagtccagacctgggaattgagaactatggcgtttctataacaacactg
actgaggtctttctgaaactggaaggaaaatcatctattgaccaatcagatattggtatg
acagaagatgtacaagctggaggggcaaggagcccagagaggtttgctgaagtagaacaa
cttgtctctttacttaatgggaggtgtaagatgaaggggggcatggctctatggtggcag
caactctgtgcagtgaccaggcttcgcttcttgaagttaaagcatgaaaggaaatccatc
gttattctgattctggttttggggattggacttctgcatattttgtcagcaaatatttac
aggatggtccgtcaaagtgactactgttgggagcttgcccctcatatgtacttcctcaca
ccaggccagcaaccacagccgcccctcacgaacttactgatcgtcaacaaaacaggagca
aaaatcgatgactttatacattcactggaacaacagaacatagctttggaagttgatgcc
tttgggactagaaatggcaccgaggacagtcagtataatggagctatcatcctatcaggt
gacgagaagaattacaactttaccctggcatgcaacaccaagaggctgaattgttttccg
gttctggtggatattgtgagtaatgggctacttggactgttcgcaccatcagcacacatt
caaactgaccgcagcacatttcctgaggaaaatgaccacagaaaatttgattatttggct
tatttcttcttgtgggtacttctgatggcctgtgttcctccttatatttccatgaccagc
attgatgactataagaacagagctcagttccagctgtggatttcagggctctccccatct
gcatactggttcgggcaggctctgtttgaggttccagtgtactgtgcactcattttgtct
atattcattgcattctatgcctcggcccctccagagagtaagttcacagttggagatctg
tttattcagattctctatgttggtggctatgccatgtcagttattttcatgacttatgtg
atttcattcatttatcgcaaggggagaaaaaatagtggcctttggtcactttgcttctat
attgtctctttcttctctatgtgttttatgcttattgattactttagagatatctcactg
tttgttttaattgccctggttccacctgctacattgggaggctgcacattattacatttt
gagaatcgtgaattttctgaaataatttttgagccagaaagggagtattcctatctgttt
ttcctagctcctcttcttcattttgccatcttcgtagttattctccgatgtatggaaagg
aagtttggaatgaaaacaatgagaacggatcctgtctttagaatttctccaagaagcgat
cgtgtatttaacaatccagaagacccagatggggaagatgaagatgtgagtcaggaaaga
gtgtggacagcaaatgctttgacttccgccgacttccaggagaagccagccatcattgcc
agctgccttcgcaaggagtacaagggaaagaagaaatgctttgttcttaagagcaagaag
aagattgccacaagaaacatctctttttgcgttcgaaaaggtgaggttgtaggattactg
ggacacaatggagctggtaaaagtacatccattaagatgataactggagaaaccaagcca
agcgccggacaggtgctgctgaaggggagcagcacaggggacaccccggggttcctgggg
tactgtcctcaggaaaatgctctgtggctcaacctgacagtgagggaacacctggagata
tttgcagccataaaggggatgagaaaaagtgacgcgaacgtggccatcgaaaggttggca
gatgcgctcaagctgcaggaccagctgaagtctcctgtgaagacgctgtcagagggagtg
aagagaaagctgtgctttgtgctgagcatcctggggaacccttctgtggtacttctggat
gagccatccaccgggatggaccccgaggggcagcagcaaatgtggcaggctatccaggcc
accttttcaaacacagaacggggcgccctcctgaccacccattacatggcagaggctgag
gctgtgtgtgaccgcgtggccatcatggtgtctgggaggctgagatgtattggatccatc
caacatctgaagagcaaattcggcaaagaatatctcctggagatgaaggtgaagaccccc
tcgcaggtggagcccttgaacacggagatcatgaggctgttcccccaggctgctcggcag
gaaaggtactcttctctgatggtctataaactgcccagggaagatgtgcaacctttatcc
caggccttcttcaaattagagacagttaaacagagctttgacctggaggagtacagcctt
tcacagtccaccctggagcaggtcttcctggagctctctaaggagcaggagctggacggt
tttgaagaggaacttgatccctcagtcaagtggaagctcctcccacaggaagaggcgtaa

DBGET integrated database retrieval system